BLASTX nr result
ID: Dioscorea21_contig00034268
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00034268 (268 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK37730.1| unknown [Medicago truncatula] 63 3e-08 ref|XP_003543227.1| PREDICTED: PRA1 family protein H-like [Glyci... 62 6e-08 ref|XP_002532934.1| conserved hypothetical protein [Ricinus comm... 59 3e-07 ref|XP_002867498.1| hypothetical protein ARALYDRAFT_492039 [Arab... 57 2e-06 ref|XP_002316885.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 >gb|AFK37730.1| unknown [Medicago truncatula] Length = 229 Score = 62.8 bits (151), Expect = 3e-08 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = -1 Query: 106 MVFSANPLALSVPEPAFEAWLRDTGYLEVLDSQ 8 MVFS+NPLALSVPEPAFE+WLRDTGYLE++D + Sbjct: 1 MVFSSNPLALSVPEPAFESWLRDTGYLELIDQR 33 >ref|XP_003543227.1| PREDICTED: PRA1 family protein H-like [Glycine max] Length = 222 Score = 61.6 bits (148), Expect = 6e-08 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = -1 Query: 106 MVFSANPLALSVPEPAFEAWLRDTGYLEVLD 14 MVFS+NPL+LSVPEPAFE+WLRDTG+LEVLD Sbjct: 1 MVFSSNPLSLSVPEPAFESWLRDTGFLEVLD 31 >ref|XP_002532934.1| conserved hypothetical protein [Ricinus communis] gi|223527298|gb|EEF29450.1| conserved hypothetical protein [Ricinus communis] Length = 235 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/31 (80%), Positives = 31/31 (100%) Frame = -1 Query: 106 MVFSANPLALSVPEPAFEAWLRDTGYLEVLD 14 MVFS+NPL+LSVP+PAFE+WLRD+GYLE+LD Sbjct: 1 MVFSSNPLSLSVPDPAFESWLRDSGYLELLD 31 >ref|XP_002867498.1| hypothetical protein ARALYDRAFT_492039 [Arabidopsis lyrata subsp. lyrata] gi|297313334|gb|EFH43757.1| hypothetical protein ARALYDRAFT_492039 [Arabidopsis lyrata subsp. lyrata] Length = 241 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -1 Query: 106 MVFSANPLALSVPEPAFEAWLRDTGYLEVLD 14 M FS NPL+LSVP+PAFE+WLRD+GYLE+LD Sbjct: 1 MAFSPNPLSLSVPDPAFESWLRDSGYLELLD 31 >ref|XP_002316885.1| predicted protein [Populus trichocarpa] gi|222859950|gb|EEE97497.1| predicted protein [Populus trichocarpa] Length = 229 Score = 57.0 bits (136), Expect = 2e-06 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = -1 Query: 106 MVFSANPLALSVPEPAFEAWLRDTGYLEVLD 14 MVFS+NPL+LSVP+P F+ WLRD+GYLE+LD Sbjct: 1 MVFSSNPLSLSVPDPTFDTWLRDSGYLEILD 31