BLASTX nr result
ID: Dioscorea21_contig00034142
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00034142 (261 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002462377.1| hypothetical protein SORBIDRAFT_02g024620 [S... 55 5e-06 >ref|XP_002462377.1| hypothetical protein SORBIDRAFT_02g024620 [Sorghum bicolor] gi|241925754|gb|EER98898.1| hypothetical protein SORBIDRAFT_02g024620 [Sorghum bicolor] Length = 1127 Score = 55.5 bits (132), Expect = 5e-06 Identities = 30/76 (39%), Positives = 42/76 (55%), Gaps = 4/76 (5%) Frame = +1 Query: 22 EREQSDFEEEETSSLSFKFEYQISEDSLSCSEE----PAMVTNVSKYCFLSENDFKGFVQ 189 ++++ E EET F E ++ E S +E P +V Y FL+E DF+GFV+ Sbjct: 161 DKQEHQHEAEETE---FVVEEEVEEQSREVVQEEAAPPKIVATTHNYQFLTERDFRGFVR 217 Query: 190 EPEYMTFHIQESFADP 237 EPE MT +QESF P Sbjct: 218 EPEAMTVRVQESFVPP 233