BLASTX nr result
ID: Dioscorea21_contig00034110
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00034110 (173 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_192570.2| nodulin MtN21 /EamA-like transporter family pro... 55 6e-06 emb|CAB45800.1| nodulin-like protein [Arabidopsis thaliana] gi|7... 55 6e-06 >ref|NP_192570.2| nodulin MtN21 /EamA-like transporter family protein [Arabidopsis thaliana] gi|63003784|gb|AAY25421.1| At4g08300 [Arabidopsis thaliana] gi|110738842|dbj|BAF01344.1| nodulin-like protein [Arabidopsis thaliana] gi|332657223|gb|AEE82623.1| nodulin MtN21 /EamA-like transporter family protein [Arabidopsis thaliana] Length = 373 Score = 55.1 bits (131), Expect = 6e-06 Identities = 28/57 (49%), Positives = 38/57 (66%) Frame = -1 Query: 173 ILSWILRSERVKLNEWRSIAKVVGTILSVSGAMVMTPYKGPKIWMLCTREGTLDNGT 3 I++ I R E V L + RS+AKV+GT ++V GAMVMT YKGP I + T +L G+ Sbjct: 117 IMAVIFRIETVNLKKTRSLAKVIGTAITVGGAMVMTLYKGPAIELFKTAHSSLHGGS 173 >emb|CAB45800.1| nodulin-like protein [Arabidopsis thaliana] gi|7267471|emb|CAB77955.1| nodulin-like protein [Arabidopsis thaliana] Length = 368 Score = 55.1 bits (131), Expect = 6e-06 Identities = 28/57 (49%), Positives = 38/57 (66%) Frame = -1 Query: 173 ILSWILRSERVKLNEWRSIAKVVGTILSVSGAMVMTPYKGPKIWMLCTREGTLDNGT 3 I++ I R E V L + RS+AKV+GT ++V GAMVMT YKGP I + T +L G+ Sbjct: 112 IMAVIFRIETVNLKKTRSLAKVIGTAITVGGAMVMTLYKGPAIELFKTAHSSLHGGS 168