BLASTX nr result
ID: Dioscorea21_contig00033417
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00033417 (399 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002313273.1| predicted protein [Populus trichocarpa] gi|2... 102 3e-20 ref|XP_003528600.1| PREDICTED: pentatricopeptide repeat-containi... 100 2e-19 emb|CBI35582.3| unnamed protein product [Vitis vinifera] 96 4e-18 ref|XP_004169216.1| PREDICTED: pentatricopeptide repeat-containi... 90 2e-16 ref|XP_004140275.1| PREDICTED: pentatricopeptide repeat-containi... 90 2e-16 >ref|XP_002313273.1| predicted protein [Populus trichocarpa] gi|222849681|gb|EEE87228.1| predicted protein [Populus trichocarpa] Length = 680 Score = 102 bits (254), Expect = 3e-20 Identities = 43/64 (67%), Positives = 55/64 (85%) Frame = -1 Query: 399 PGHSGYYTLLSNMYAEAARWDEANEIRKLMKTRRVRKNPGCSWVQSDNCMHAFLGGERME 220 P HSGYY++LSNMYAEA +WDEAN++RKLMK+R +KNPGCSWVQ DN +HAF+ GERM Sbjct: 610 PQHSGYYSVLSNMYAEAGKWDEANQVRKLMKSRGAKKNPGCSWVQIDNQVHAFVAGERMM 669 Query: 219 ELET 208 +++ Sbjct: 670 NVDS 673 >ref|XP_003528600.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, chloroplastic-like [Glycine max] Length = 813 Score = 99.8 bits (247), Expect = 2e-19 Identities = 43/66 (65%), Positives = 54/66 (81%) Frame = -1 Query: 399 PGHSGYYTLLSNMYAEAARWDEANEIRKLMKTRRVRKNPGCSWVQSDNCMHAFLGGERME 220 P H GYY LLSNMYAEA RWDEAN++R+LMK+R +KNPGCSWVQ + +HAFL GE+++ Sbjct: 742 PQHCGYYILLSNMYAEAERWDEANKVRELMKSRGAKKNPGCSWVQVGDLVHAFLVGEKID 801 Query: 219 ELETDF 202 L+ DF Sbjct: 802 SLDDDF 807 >emb|CBI35582.3| unnamed protein product [Vitis vinifera] Length = 638 Score = 95.5 bits (236), Expect = 4e-18 Identities = 43/63 (68%), Positives = 51/63 (80%) Frame = -1 Query: 399 PGHSGYYTLLSNMYAEAARWDEANEIRKLMKTRRVRKNPGCSWVQSDNCMHAFLGGERME 220 P HSGYYTLLSNMYAE RWDEAN IR+LMK+R V+K+PGCSWVQ HAF+ GE++E Sbjct: 543 PEHSGYYTLLSNMYAETGRWDEANRIRELMKSRGVKKSPGCSWVQIGEQAHAFVVGEKIE 602 Query: 219 ELE 211 L+ Sbjct: 603 GLD 605 >ref|XP_004169216.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18750, chloroplastic-like [Cucumis sativus] Length = 684 Score = 90.1 bits (222), Expect = 2e-16 Identities = 42/72 (58%), Positives = 51/72 (70%) Frame = -1 Query: 399 PGHSGYYTLLSNMYAEAARWDEANEIRKLMKTRRVRKNPGCSWVQSDNCMHAFLGGERME 220 P H GYY LLSN+YAE RWDEAN+IR+LMK+R +KNPGCSWVQ + +HAF+ ER+E Sbjct: 613 PQHCGYYILLSNIYAETGRWDEANKIRELMKSRGAKKNPGCSWVQIYDQVHAFVAEERVE 672 Query: 219 ELETDFCFEEQV 184 E E V Sbjct: 673 GFELGDWLAESV 684 >ref|XP_004140275.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18750, chloroplastic-like [Cucumis sativus] Length = 833 Score = 90.1 bits (222), Expect = 2e-16 Identities = 42/72 (58%), Positives = 51/72 (70%) Frame = -1 Query: 399 PGHSGYYTLLSNMYAEAARWDEANEIRKLMKTRRVRKNPGCSWVQSDNCMHAFLGGERME 220 P H GYY LLSN+YAE RWDEAN+IR+LMK+R +KNPGCSWVQ + +HAF+ ER+E Sbjct: 762 PQHCGYYILLSNIYAETGRWDEANKIRELMKSRGAKKNPGCSWVQIYDQVHAFVAEERVE 821 Query: 219 ELETDFCFEEQV 184 E E V Sbjct: 822 GFELGDWLAESV 833