BLASTX nr result
ID: Dioscorea21_contig00033331
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00033331 (257 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003553142.1| PREDICTED: putative nuclease HARBI1-like [Gl... 59 3e-07 ref|XP_003522292.1| PREDICTED: putative nuclease HARBI1-like [Gl... 57 2e-06 ref|XP_003518029.1| PREDICTED: uncharacterized protein LOC100803... 57 2e-06 >ref|XP_003553142.1| PREDICTED: putative nuclease HARBI1-like [Glycine max] Length = 379 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/58 (48%), Positives = 39/58 (67%) Frame = +1 Query: 46 YVLQSMMSHAFRSPNEIFNYYH*SLRSVIERTFQVCKSRWRILQYMTKYRPKVQFQII 219 ++ Q + R E+FNYYH SLRS+IER F +CK+RW+IL M+ + K+Q QII Sbjct: 264 HLSQFRIGPRIRGRVEVFNYYHSSLRSIIERAFGLCKARWKILGNMSPFALKIQNQII 321 >ref|XP_003522292.1| PREDICTED: putative nuclease HARBI1-like [Glycine max] Length = 401 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/47 (57%), Positives = 32/47 (68%) Frame = +1 Query: 79 RSPNEIFNYYH*SLRSVIERTFQVCKSRWRILQYMTKYRPKVQFQII 219 R E+FNYYH SLRS IER F +CK RW+IL M+ + K Q QII Sbjct: 294 RGRAEVFNYYHSSLRSTIERAFGLCKERWKILGNMSPFALKTQNQII 340 >ref|XP_003518029.1| PREDICTED: uncharacterized protein LOC100803756 [Glycine max] Length = 409 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +1 Query: 91 EIFNYYH*SLRSVIERTFQVCKSRWRILQYMTKYRPKVQFQII 219 E+FNYYH SLRS IER F +CK+RW+IL M+ + K Q QII Sbjct: 298 EVFNYYHSSLRSTIERAFGLCKARWKILGNMSPFALKTQNQII 340