BLASTX nr result
ID: Dioscorea21_contig00033310
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00033310 (340 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002450288.1| hypothetical protein SORBIDRAFT_05g003280 [S... 55 6e-06 >ref|XP_002450288.1| hypothetical protein SORBIDRAFT_05g003280 [Sorghum bicolor] gi|241936131|gb|EES09276.1| hypothetical protein SORBIDRAFT_05g003280 [Sorghum bicolor] Length = 250 Score = 55.1 bits (131), Expect = 6e-06 Identities = 34/74 (45%), Positives = 45/74 (60%), Gaps = 2/74 (2%) Frame = +1 Query: 97 PAESILIRIDDGFDWSDLNAAVFSREFSTKGSTNPKSMIQSHXXXXXXXXXLS-TSQRFS 273 PAES +RI D WS++N V+ R+ S K +TNPKS++++H + TSQRFS Sbjct: 12 PAESTRLRIGDEITWSEING-VYDRDDSLKENTNPKSLLKNHHPGAGPHANNNGTSQRFS 70 Query: 274 ANPK-LRAPIIGFS 312 N K APIIG S Sbjct: 71 GNLKPTAAPIIGLS 84