BLASTX nr result
ID: Dioscorea21_contig00033273
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00033273 (260 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002968459.1| hypothetical protein SELMODRAFT_89304 [Selag... 57 1e-06 ref|XP_002970633.1| hypothetical protein SELMODRAFT_441216 [Sela... 57 1e-06 >ref|XP_002968459.1| hypothetical protein SELMODRAFT_89304 [Selaginella moellendorffii] gi|300164103|gb|EFJ30713.1| hypothetical protein SELMODRAFT_89304 [Selaginella moellendorffii] Length = 636 Score = 57.4 bits (137), Expect = 1e-06 Identities = 30/49 (61%), Positives = 38/49 (77%), Gaps = 3/49 (6%) Frame = +2 Query: 116 PTLTAGAISAVEAGDLELRPVVQVVEVKPI---QSTQERYRVVVSDGAA 253 P+LT AI A+ GDLELRP+VQV++VK I Q+ QERYR+V+SDG A Sbjct: 4 PSLTPNAIVALLGGDLELRPIVQVLDVKQIGSNQNVQERYRLVLSDGTA 52 >ref|XP_002970633.1| hypothetical protein SELMODRAFT_441216 [Selaginella moellendorffii] gi|300162149|gb|EFJ28763.1| hypothetical protein SELMODRAFT_441216 [Selaginella moellendorffii] Length = 815 Score = 57.4 bits (137), Expect = 1e-06 Identities = 30/49 (61%), Positives = 38/49 (77%), Gaps = 3/49 (6%) Frame = +2 Query: 116 PTLTAGAISAVEAGDLELRPVVQVVEVKPI---QSTQERYRVVVSDGAA 253 P+LT AI A+ GDLELRP+VQV++VK I Q+ QERYR+V+SDG A Sbjct: 4 PSLTPNAIVALLGGDLELRPIVQVLDVKQIGSNQNVQERYRLVLSDGTA 52