BLASTX nr result
ID: Dioscorea21_contig00033136
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00033136 (365 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ93405.1| predicted protein [Hordeum vulgare subsp. vulgare] 59 3e-07 ref|NP_001052187.2| Os04g0183500 [Oryza sativa Japonica Group] g... 59 5e-07 gb|EEE65500.1| hypothetical protein OsJ_20931 [Oryza sativa Japo... 59 5e-07 gb|EEE60583.1| hypothetical protein OsJ_13961 [Oryza sativa Japo... 59 5e-07 gb|EEC80374.1| hypothetical protein OsI_22488 [Oryza sativa Indi... 59 5e-07 >dbj|BAJ93405.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 507 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +1 Query: 1 PFGLCFSGLKGFEPRLIEIAYAFEQATNVR 90 PFG+CF GL+G+EPRLIE+AYAFEQATNVR Sbjct: 471 PFGICFGGLQGYEPRLIEMAYAFEQATNVR 500 >ref|NP_001052187.2| Os04g0183500 [Oryza sativa Japonica Group] gi|38346902|emb|CAE04397.2| OSJNBb0006L01.9 [Oryza sativa Japonica Group] gi|255675187|dbj|BAF14101.2| Os04g0183500 [Oryza sativa Japonica Group] Length = 511 Score = 58.5 bits (140), Expect = 5e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +1 Query: 1 PFGLCFSGLKGFEPRLIEIAYAFEQATNVR 90 PFG+CF GLKG+EPRLIE+AYAFEQAT VR Sbjct: 475 PFGICFGGLKGYEPRLIEMAYAFEQATKVR 504 >gb|EEE65500.1| hypothetical protein OsJ_20931 [Oryza sativa Japonica Group] Length = 480 Score = 58.5 bits (140), Expect = 5e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +1 Query: 1 PFGLCFSGLKGFEPRLIEIAYAFEQATNVR 90 PFG+CF GLKG+EPRLIE+AYAFEQAT VR Sbjct: 441 PFGICFGGLKGYEPRLIEMAYAFEQATKVR 470 >gb|EEE60583.1| hypothetical protein OsJ_13961 [Oryza sativa Japonica Group] Length = 533 Score = 58.5 bits (140), Expect = 5e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +1 Query: 1 PFGLCFSGLKGFEPRLIEIAYAFEQATNVR 90 PFG+CF GLKG+EPRLIE+AYAFEQAT VR Sbjct: 497 PFGICFGGLKGYEPRLIEMAYAFEQATKVR 526 >gb|EEC80374.1| hypothetical protein OsI_22488 [Oryza sativa Indica Group] Length = 316 Score = 58.5 bits (140), Expect = 5e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +1 Query: 1 PFGLCFSGLKGFEPRLIEIAYAFEQATNVR 90 PFG+CF GLKG+EPRLIE+AYAFEQAT VR Sbjct: 277 PFGICFGGLKGYEPRLIEMAYAFEQATKVR 306