BLASTX nr result
ID: Dioscorea21_contig00032455
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00032455 (236 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002311584.1| nucleobase ascorbate transporter [Populus tr... 92 3e-17 ref|XP_002268811.1| PREDICTED: nucleobase-ascorbate transporter ... 92 3e-17 ref|XP_004135225.1| PREDICTED: nucleobase-ascorbate transporter ... 92 6e-17 ref|XP_002315809.1| nucleobase ascorbate transporter [Populus tr... 91 1e-16 ref|XP_003613313.1| Nucleobase ascorbate transporter [Medicago t... 91 1e-16 >ref|XP_002311584.1| nucleobase ascorbate transporter [Populus trichocarpa] gi|222851404|gb|EEE88951.1| nucleobase ascorbate transporter [Populus trichocarpa] Length = 534 Score = 92.4 bits (228), Expect = 3e-17 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = -2 Query: 124 PKQDELQPHPVKDQLPNVAYCITSPPPWPEAILLGFQHYLV 2 PKQ+ELQPHPVKDQLPN+AYCITSPPPWPEAILLGFQHYLV Sbjct: 11 PKQEELQPHPVKDQLPNIAYCITSPPPWPEAILLGFQHYLV 51 >ref|XP_002268811.1| PREDICTED: nucleobase-ascorbate transporter 6 [Vitis vinifera] gi|296086499|emb|CBI32088.3| unnamed protein product [Vitis vinifera] Length = 541 Score = 92.4 bits (228), Expect = 3e-17 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -2 Query: 124 PKQDELQPHPVKDQLPNVAYCITSPPPWPEAILLGFQHYLV 2 PKQDELQPHP KDQLPN+AYCITSPPPWPEAILLGFQHYLV Sbjct: 18 PKQDELQPHPAKDQLPNIAYCITSPPPWPEAILLGFQHYLV 58 >ref|XP_004135225.1| PREDICTED: nucleobase-ascorbate transporter 7-like [Cucumis sativus] gi|449478527|ref|XP_004155342.1| PREDICTED: nucleobase-ascorbate transporter 7-like [Cucumis sativus] Length = 534 Score = 91.7 bits (226), Expect = 6e-17 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = -2 Query: 124 PKQDELQPHPVKDQLPNVAYCITSPPPWPEAILLGFQHYLV 2 PKQ+ELQPHPVKDQLPNV+YCITSPPPWPEAILLGFQHYLV Sbjct: 11 PKQEELQPHPVKDQLPNVSYCITSPPPWPEAILLGFQHYLV 51 >ref|XP_002315809.1| nucleobase ascorbate transporter [Populus trichocarpa] gi|222864849|gb|EEF01980.1| nucleobase ascorbate transporter [Populus trichocarpa] Length = 534 Score = 90.9 bits (224), Expect = 1e-16 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -2 Query: 124 PKQDELQPHPVKDQLPNVAYCITSPPPWPEAILLGFQHYLV 2 PKQ+ELQPHP KDQLPN+AYCITSPPPWPEAILLGFQHYLV Sbjct: 11 PKQEELQPHPAKDQLPNIAYCITSPPPWPEAILLGFQHYLV 51 >ref|XP_003613313.1| Nucleobase ascorbate transporter [Medicago truncatula] gi|355514648|gb|AES96271.1| Nucleobase ascorbate transporter [Medicago truncatula] Length = 538 Score = 90.9 bits (224), Expect = 1e-16 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -2 Query: 124 PKQDELQPHPVKDQLPNVAYCITSPPPWPEAILLGFQHYLV 2 PKQDE QPHPVKDQLPNV+YCITSPPPWPEAI+LGFQHYLV Sbjct: 14 PKQDEFQPHPVKDQLPNVSYCITSPPPWPEAIMLGFQHYLV 54