BLASTX nr result
ID: Dioscorea21_contig00032057
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00032057 (280 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_001294396.1| hypothetical chloroplast RF2 [Dioscorea elep... 56 3e-06 gb|AEK48536.1| photosystem I assembly protein Ycf2 (chloroplast)... 55 6e-06 ref|YP_005097917.1| photosystem I assembly protein Ycf2 (chlorop... 55 6e-06 gb|ABQ14933.1| Ycf2 [Saxifraga stolonifera] 55 8e-06 emb|CAI53855.1| ycf2 [Acorus calamus] 54 1e-05 >ref|YP_001294396.1| hypothetical chloroplast RF2 [Dioscorea elephantipes] gi|149390416|ref|YP_001294415.1| hypothetical chloroplast RF2 [Dioscorea elephantipes] gi|205412894|sp|A6MMQ1.1|YCF2_DIOEL RecName: Full=Protein ycf2 gi|148668089|gb|ABR01473.1| hypothetical chloroplast RF2 [Dioscorea elephantipes] gi|148668108|gb|ABR01492.1| hypothetical chloroplast RF2 [Dioscorea elephantipes] Length = 2260 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = -2 Query: 228 EP*GILIKWSNGSNNFHKHLKHFISEQKNRFQVEF 124 +P KWSNGS NF KHL+HFISEQKNRFQV F Sbjct: 782 DPDAYRYKWSNGSKNFQKHLEHFISEQKNRFQVVF 816 >gb|AEK48536.1| photosystem I assembly protein Ycf2 (chloroplast) [Colocasia esculenta] gi|340536789|gb|AEK48555.1| photosystem I assembly protein Ycf2 (chloroplast) [Colocasia esculenta] Length = 2308 Score = 55.1 bits (131), Expect = 6e-06 Identities = 22/28 (78%), Positives = 26/28 (92%) Frame = -2 Query: 207 KWSNGSNNFHKHLKHFISEQKNRFQVEF 124 KWSNGSNNF +HL+HF+SEQ+NRFQV F Sbjct: 818 KWSNGSNNFQEHLEHFVSEQRNRFQVVF 845 >ref|YP_005097917.1| photosystem I assembly protein Ycf2 (chloroplast) [Colocasia esculenta] gi|377819441|ref|YP_005097936.1| photosystem I assembly protein Ycf2 (chloroplast) [Colocasia esculenta] gi|340536683|gb|AEK48450.1| photosystem I assembly protein Ycf2 (chloroplast) [Colocasia esculenta] gi|340536702|gb|AEK48469.1| photosystem I assembly protein Ycf2 (chloroplast) [Colocasia esculenta] Length = 2308 Score = 55.1 bits (131), Expect = 6e-06 Identities = 22/28 (78%), Positives = 26/28 (92%) Frame = -2 Query: 207 KWSNGSNNFHKHLKHFISEQKNRFQVEF 124 KWSNGSNNF +HL+HF+SEQ+NRFQV F Sbjct: 818 KWSNGSNNFQEHLEHFVSEQRNRFQVVF 845 >gb|ABQ14933.1| Ycf2 [Saxifraga stolonifera] Length = 2274 Score = 54.7 bits (130), Expect = 8e-06 Identities = 23/35 (65%), Positives = 28/35 (80%) Frame = -2 Query: 228 EP*GILIKWSNGSNNFHKHLKHFISEQKNRFQVEF 124 +P KWSNGSNNF +HL+HF+SEQK+RFQV F Sbjct: 810 DPNAYRYKWSNGSNNFQEHLEHFVSEQKSRFQVVF 844 >emb|CAI53855.1| ycf2 [Acorus calamus] Length = 2091 Score = 54.3 bits (129), Expect = 1e-05 Identities = 23/35 (65%), Positives = 27/35 (77%) Frame = -2 Query: 228 EP*GILIKWSNGSNNFHKHLKHFISEQKNRFQVEF 124 +P KWSNGS NF +HL+HF+SEQKNRFQV F Sbjct: 683 DPNAYRYKWSNGSKNFQEHLEHFVSEQKNRFQVVF 717