BLASTX nr result
ID: Dioscorea21_contig00031941
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00031941 (244 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280262.1| PREDICTED: uncharacterized protein LOC100249... 46 4e-06 emb|CBI27985.3| unnamed protein product [Vitis vinifera] 46 4e-06 >ref|XP_002280262.1| PREDICTED: uncharacterized protein LOC100249186 [Vitis vinifera] Length = 184 Score = 46.2 bits (108), Expect(2) = 4e-06 Identities = 21/30 (70%), Positives = 26/30 (86%) Frame = -3 Query: 95 LHCRKGLSKYYQGKAQSFTSLSDAKSLEDL 6 L ++GLSKY+QGK+QSFTSL+ KSLEDL Sbjct: 89 LPIKRGLSKYFQGKSQSFTSLASVKSLEDL 118 Score = 29.3 bits (64), Expect(2) = 4e-06 Identities = 12/23 (52%), Positives = 18/23 (78%) Frame = -1 Query: 235 ATSSLNKQPLYQMSSVKAELPIK 167 +TS L+ PLY++S + A+LPIK Sbjct: 70 STSPLSNGPLYELSELMAQLPIK 92 >emb|CBI27985.3| unnamed protein product [Vitis vinifera] Length = 154 Score = 46.2 bits (108), Expect(2) = 4e-06 Identities = 21/30 (70%), Positives = 26/30 (86%) Frame = -3 Query: 95 LHCRKGLSKYYQGKAQSFTSLSDAKSLEDL 6 L ++GLSKY+QGK+QSFTSL+ KSLEDL Sbjct: 59 LPIKRGLSKYFQGKSQSFTSLASVKSLEDL 88 Score = 29.3 bits (64), Expect(2) = 4e-06 Identities = 12/23 (52%), Positives = 18/23 (78%) Frame = -1 Query: 235 ATSSLNKQPLYQMSSVKAELPIK 167 +TS L+ PLY++S + A+LPIK Sbjct: 40 STSPLSNGPLYELSELMAQLPIK 62