BLASTX nr result
ID: Dioscorea21_contig00031704
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00031704 (566 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523406.1| RNA binding protein, putative [Ricinus commu... 59 4e-07 >ref|XP_002523406.1| RNA binding protein, putative [Ricinus communis] gi|223537356|gb|EEF38985.1| RNA binding protein, putative [Ricinus communis] Length = 771 Score = 59.3 bits (142), Expect = 4e-07 Identities = 51/194 (26%), Positives = 76/194 (39%), Gaps = 13/194 (6%) Frame = -1 Query: 548 PNAETNAAFELLPGVPFPGMELTASAFQQQYCFDVHSTA-CVPSYDR-----AWQNIERG 387 P A F+ L V PG++ + Q+QY D+ S C+ + +W+NIE Sbjct: 184 PLAHGVQGFQFLSNVAVPGIDFPLMSDQRQYFADMQSVLPCIHAQQFNQPHISWRNIEEE 243 Query: 386 GHYNMQQQFFYPPCLHKQGFP-------NGTFSGIRSVGSTTEPYIKLPDSHHIQHFNGN 228 Y M QQ+ Y LH Q NG + +PY ++P SH +Q N Sbjct: 244 QFYRMHQQYLYLQQLHNQRLEAQHPMQANGNVATKLMNRHVRQPYFEVPVSHQLQQPNQE 303 Query: 227 LYWNDYLLYKRHNEPKFPAIGGGVYQCNPYVQKQTSTNEQTFLAKDDNDHLFMDRKLVSP 48 WNDY A+ G+ Q + +Q+F P Sbjct: 304 QVWNDY------------AVTRGLNQSQNGMNILDEVGKQSF-----------------P 334 Query: 47 IKILTRSDDMNSLR 6 KILTRS +++L+ Sbjct: 335 EKILTRSQGLSTLK 348