BLASTX nr result
ID: Dioscorea21_contig00031647
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00031647 (245 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN66630.1| hypothetical protein VITISV_013578 [Vitis vinifera] 56 3e-06 emb|CAN60366.1| hypothetical protein VITISV_031870 [Vitis vinifera] 55 8e-06 gb|AAT38758.1| Putative gag-pol polyprotein, identical [Solanum ... 55 8e-06 >emb|CAN66630.1| hypothetical protein VITISV_013578 [Vitis vinifera] Length = 200 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/51 (50%), Positives = 35/51 (68%) Frame = +3 Query: 3 RNLVNEKTVQLEYCSTEDQIADIFTKCLDTRKQHKFRFLLGVCSLQSRGSM 155 R+LV E V L+YC+T +Q+AD+ TK L K FR LGVC+ +SRGS+ Sbjct: 148 RBLVVEGKVVLQYCNTNEQVADVLTKALSRDKHVYFRSKLGVCNFESRGSV 198 >emb|CAN60366.1| hypothetical protein VITISV_031870 [Vitis vinifera] Length = 1274 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/51 (50%), Positives = 35/51 (68%) Frame = +3 Query: 3 RNLVNEKTVQLEYCSTEDQIADIFTKCLDTRKQHKFRFLLGVCSLQSRGSM 155 R+LV E V L+YC+T +Q+AD+ TK L K FR LGVC+ +SRGS+ Sbjct: 1222 RDLVVEGKVVLQYCNTNEQVADVLTKALSRDKHVYFRSKLGVCNFESRGSV 1272 >gb|AAT38758.1| Putative gag-pol polyprotein, identical [Solanum demissum] Length = 1333 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/51 (50%), Positives = 33/51 (64%) Frame = +3 Query: 3 RNLVNEKTVQLEYCSTEDQIADIFTKCLDTRKQHKFRFLLGVCSLQSRGSM 155 R LV + + L++CST +Q ADIFTK L K FR LGVC +SRGS+ Sbjct: 1282 RTLVADGRIVLKFCSTNEQAADIFTKSLPQAKHEYFRLQLGVCDFESRGSV 1332