BLASTX nr result
ID: Dioscorea21_contig00031619
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00031619 (272 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003518708.1| PREDICTED: abscisate beta-glucosyltransferas... 87 2e-15 ref|XP_003520066.1| PREDICTED: abscisate beta-glucosyltransferas... 82 3e-14 ref|XP_002518735.1| UDP-glucosyltransferase, putative [Ricinus c... 82 3e-14 ref|XP_002518724.1| UDP-glucosyltransferase, putative [Ricinus c... 82 6e-14 sp|Q8W3P8.1|AOG_PHAAN RecName: Full=Abscisate beta-glucosyltrans... 81 8e-14 >ref|XP_003518708.1| PREDICTED: abscisate beta-glucosyltransferase-like isoform 1 [Glycine max] gi|356499769|ref|XP_003518709.1| PREDICTED: abscisate beta-glucosyltransferase-like isoform 2 [Glycine max] Length = 475 Score = 86.7 bits (213), Expect = 2e-15 Identities = 36/86 (41%), Positives = 58/86 (67%) Frame = -1 Query: 263 DDEPFIVPMIPHEIKLMRSELPTYVLKPNDDIHRMAKAQGKSYGMVMNTFHELEAEYAEL 84 D EPF+VP +P I++ RS+LP ++ P+ R+ + + KS+G +N+FH+LE YAE Sbjct: 153 DSEPFVVPNLPDRIEMTRSQLPVFLRTPSQFPDRVRQLEEKSFGTFVNSFHDLEPAYAEQ 212 Query: 83 LKMSWHMRVWLVGPVSLCNQGLLDQS 6 +K W + W++GPVSLCN+ D++ Sbjct: 213 VKNKWGKKAWIIGPVSLCNRTAEDKT 238 >ref|XP_003520066.1| PREDICTED: abscisate beta-glucosyltransferase-like [Glycine max] Length = 475 Score = 82.4 bits (202), Expect = 3e-14 Identities = 36/89 (40%), Positives = 62/89 (69%) Frame = -1 Query: 272 VTGDDEPFIVPMIPHEIKLMRSELPTYVLKPNDDIHRMAKAQGKSYGMVMNTFHELEAEY 93 ++ D EPF+VP +PH I++ RS++P ++ P+ RM + + KS+G+V N+F++LE +Y Sbjct: 152 LSSDLEPFVVPNLPHHIEMTRSQVPIFLRSPSPFPDRMRQLEEKSFGIVTNSFYDLEPDY 211 Query: 92 AELLKMSWHMRVWLVGPVSLCNQGLLDQS 6 A+ LK + W++GPVSLCN+ D++ Sbjct: 212 ADYLKKG--TKAWIIGPVSLCNRTAEDKT 238 >ref|XP_002518735.1| UDP-glucosyltransferase, putative [Ricinus communis] gi|223542116|gb|EEF43660.1| UDP-glucosyltransferase, putative [Ricinus communis] Length = 473 Score = 82.4 bits (202), Expect = 3e-14 Identities = 40/89 (44%), Positives = 60/89 (67%) Frame = -1 Query: 272 VTGDDEPFIVPMIPHEIKLMRSELPTYVLKPNDDIHRMAKAQGKSYGMVMNTFHELEAEY 93 V+ D EPF+VP +P I+L RS+L + P +D + Q +S+G+V+N+F+ELE Y Sbjct: 155 VSSDLEPFVVPGLPDRIELTRSQLAPFERNPREDDYLRRSVQ-QSFGVVVNSFYELEPAY 213 Query: 92 AELLKMSWHMRVWLVGPVSLCNQGLLDQS 6 AELL+ + WLVGPVSLCN+ + D++ Sbjct: 214 AELLQKEMGNKAWLVGPVSLCNRNIEDKA 242 >ref|XP_002518724.1| UDP-glucosyltransferase, putative [Ricinus communis] gi|223542105|gb|EEF43649.1| UDP-glucosyltransferase, putative [Ricinus communis] Length = 486 Score = 81.6 bits (200), Expect = 6e-14 Identities = 38/94 (40%), Positives = 62/94 (65%), Gaps = 5/94 (5%) Frame = -1 Query: 272 VTGDDEPFIVPMIPHEIKLMRSELPTYVLKPND-DIHRMAKA----QGKSYGMVMNTFHE 108 V+ D EPF++P +P EIK R +LP ++ + + D +M KA + KSYG+++N+F+E Sbjct: 170 VSSDSEPFVIPYLPGEIKYTRKQLPDFLRQQEENDFLKMVKAVKESELKSYGVIVNSFYE 229 Query: 107 LEAEYAELLKMSWHMRVWLVGPVSLCNQGLLDQS 6 LE+ YA+ + R W +GP+SLCN G+ D++ Sbjct: 230 LESVYADFYRKELGRRAWHIGPLSLCNSGIEDKT 263 >sp|Q8W3P8.1|AOG_PHAAN RecName: Full=Abscisate beta-glucosyltransferase; AltName: Full=ABA-glucosyltransferase gi|18151384|dbj|BAB83692.1| ABA-glucosyltransferase [Vigna angularis] Length = 478 Score = 81.3 bits (199), Expect = 8e-14 Identities = 37/92 (40%), Positives = 60/92 (65%), Gaps = 3/92 (3%) Frame = -1 Query: 272 VTGDDEPFIVPMIPHEIKLMRSELPTYVLKPNDDIHR---MAKAQGKSYGMVMNTFHELE 102 V+ D EPF+VP IP I++ S+LP ++ P+ R M + + KS+G ++N+F++LE Sbjct: 150 VSTDSEPFLVPNIPDRIEMTMSQLPPFLRNPSGIPERWRGMKQLEEKSFGTLINSFYDLE 209 Query: 101 AEYAELLKMSWHMRVWLVGPVSLCNQGLLDQS 6 YA+L+K W + W+VGPVS CN+ D++ Sbjct: 210 PAYADLIKSKWGNKAWIVGPVSFCNRSKEDKT 241