BLASTX nr result
ID: Dioscorea21_contig00031592
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00031592 (376 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN65039.1| hypothetical protein VITISV_009459 [Vitis vinifera] 55 8e-06 >emb|CAN65039.1| hypothetical protein VITISV_009459 [Vitis vinifera] Length = 1250 Score = 54.7 bits (130), Expect = 8e-06 Identities = 23/33 (69%), Positives = 26/33 (78%) Frame = +2 Query: 227 GMGTKVHCESYLPGYYTMRDPNEGVNGGWFPFY 325 GMGTKV C+SYLPGYY+MRD NE N G +P Y Sbjct: 102 GMGTKVQCKSYLPGYYSMRDLNEDSNSGGWPLY 134