BLASTX nr result
ID: Dioscorea21_contig00031553
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00031553 (256 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAM93579.1| asparagine synthase [Vigna unguiculata] 59 3e-07 gb|AAB81011.1| asparagine synthetase [Medicago sativa] 59 3e-07 gb|AAB48058.1| asparagine synthetase [Medicago sativa] 59 3e-07 gb|ABB04097.1| asparagine synthetase [Glycine max] 59 3e-07 emb|CAD43058.1| putative asparagine synthetase [Pinus sylvestris] 59 3e-07 >dbj|BAM93579.1| asparagine synthase [Vigna unguiculata] Length = 579 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +3 Query: 3 EGSDEIFGGYLYLHMAPNKVEFHQETCLKV 92 EGSDEIFGGYLY H APNK EFHQETC K+ Sbjct: 343 EGSDEIFGGYLYFHKAPNKEEFHQETCRKI 372 >gb|AAB81011.1| asparagine synthetase [Medicago sativa] Length = 586 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +3 Query: 3 EGSDEIFGGYLYLHMAPNKVEFHQETCLKV 92 EGSDEIFGGYLY H APNK EFHQETC K+ Sbjct: 344 EGSDEIFGGYLYFHKAPNKEEFHQETCRKI 373 >gb|AAB48058.1| asparagine synthetase [Medicago sativa] Length = 586 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +3 Query: 3 EGSDEIFGGYLYLHMAPNKVEFHQETCLKV 92 EGSDEIFGGYLY H APNK EFHQETC K+ Sbjct: 344 EGSDEIFGGYLYFHKAPNKEEFHQETCRKI 373 >gb|ABB04097.1| asparagine synthetase [Glycine max] Length = 579 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +3 Query: 3 EGSDEIFGGYLYLHMAPNKVEFHQETCLKV 92 EGSDEIFGGYLY H APNK EFHQETC K+ Sbjct: 343 EGSDEIFGGYLYFHKAPNKEEFHQETCRKI 372 >emb|CAD43058.1| putative asparagine synthetase [Pinus sylvestris] Length = 593 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +3 Query: 3 EGSDEIFGGYLYLHMAPNKVEFHQETCLKV 92 EGSDEIFGGYLY H APNK EFHQETC K+ Sbjct: 344 EGSDEIFGGYLYFHKAPNKEEFHQETCRKI 373