BLASTX nr result
ID: Dioscorea21_contig00030950
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00030950 (473 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002328818.1| predicted protein [Populus trichocarpa] gi|2... 55 8e-06 >ref|XP_002328818.1| predicted protein [Populus trichocarpa] gi|222839116|gb|EEE77467.1| predicted protein [Populus trichocarpa] Length = 369 Score = 54.7 bits (130), Expect = 8e-06 Identities = 23/62 (37%), Positives = 30/62 (48%) Frame = -3 Query: 336 CPSCGGPHTLAECRRASGACYRCGSMDHFIAQCPHSPPRTQGGDGTQSVTAEQPRSSDGS 157 C CGG HT AEC R +GAC+ CG + H I +CP G + + P +S Sbjct: 277 CQHCGGSHTSAECNRRTGACFSCGQIGHKIRECPRRQLSASGLSASVQHPIQAPSTSQSV 336 Query: 156 RH 151 H Sbjct: 337 AH 338