BLASTX nr result
ID: Dioscorea21_contig00030932
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00030932 (201 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW78845.1| hypothetical protein ZEAMMB73_852154 [Zea mays] 64 1e-08 ref|XP_002441396.1| hypothetical protein SORBIDRAFT_09g025880 [S... 64 1e-08 gb|ACN34763.1| unknown [Zea mays] gi|413946197|gb|AFW78846.1| hy... 64 1e-08 dbj|BAK07937.1| predicted protein [Hordeum vulgare subsp. vulgare] 63 2e-08 ref|XP_003568083.1| PREDICTED: periodic tryptophan protein 2-lik... 62 4e-08 >gb|AFW78845.1| hypothetical protein ZEAMMB73_852154 [Zea mays] Length = 885 Score = 63.9 bits (154), Expect = 1e-08 Identities = 31/59 (52%), Positives = 41/59 (69%), Gaps = 1/59 (1%) Frame = +2 Query: 8 KSYGGSKKPYMFLGHRESIVGAFFAREKNDNAYR-VYTISKDGAVFTWKLDESQHLDDS 181 K GG KP++FLGHR ++VGAFFA +K + VYT+SKDGA+FTW L E +D+ Sbjct: 173 KGLGG--KPFLFLGHRAAVVGAFFATDKKTRRVKGVYTVSKDGAIFTWDLVEGNEENDT 229 >ref|XP_002441396.1| hypothetical protein SORBIDRAFT_09g025880 [Sorghum bicolor] gi|241946681|gb|EES19826.1| hypothetical protein SORBIDRAFT_09g025880 [Sorghum bicolor] Length = 883 Score = 63.9 bits (154), Expect = 1e-08 Identities = 29/56 (51%), Positives = 39/56 (69%), Gaps = 1/56 (1%) Frame = +2 Query: 17 GGSKKPYMFLGHRESIVGAFFAREKNDNAYR-VYTISKDGAVFTWKLDESQHLDDS 181 G KP++FLGHR ++VGAFFA +K + VYT+SKDGA+FTW L E +D+ Sbjct: 174 GLGSKPFLFLGHRAAVVGAFFATDKKTGRVKGVYTVSKDGAIFTWNLVEGNEENDT 229 >gb|ACN34763.1| unknown [Zea mays] gi|413946197|gb|AFW78846.1| hypothetical protein ZEAMMB73_852154 [Zea mays] Length = 758 Score = 63.9 bits (154), Expect = 1e-08 Identities = 31/59 (52%), Positives = 41/59 (69%), Gaps = 1/59 (1%) Frame = +2 Query: 8 KSYGGSKKPYMFLGHRESIVGAFFAREKNDNAYR-VYTISKDGAVFTWKLDESQHLDDS 181 K GG KP++FLGHR ++VGAFFA +K + VYT+SKDGA+FTW L E +D+ Sbjct: 173 KGLGG--KPFLFLGHRAAVVGAFFATDKKTRRVKGVYTVSKDGAIFTWDLVEGNEENDT 229 >dbj|BAK07937.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 876 Score = 63.2 bits (152), Expect = 2e-08 Identities = 28/49 (57%), Positives = 37/49 (75%), Gaps = 1/49 (2%) Frame = +2 Query: 17 GGSKKPYMFLGHRESIVGAFFARE-KNDNAYRVYTISKDGAVFTWKLDE 160 G KP++FLGHR ++VGAFFA + K+ + VYT+SKDGA+FTW L E Sbjct: 174 GTGNKPFLFLGHRAAVVGAFFATDKKSGRVHGVYTVSKDGAIFTWNLVE 222 >ref|XP_003568083.1| PREDICTED: periodic tryptophan protein 2-like [Brachypodium distachyon] Length = 881 Score = 62.4 bits (150), Expect = 4e-08 Identities = 30/52 (57%), Positives = 38/52 (73%), Gaps = 1/52 (1%) Frame = +2 Query: 8 KSYGGSKKPYMFLGHRESIVGAFFARE-KNDNAYRVYTISKDGAVFTWKLDE 160 K GG KP++FLGHR ++VGAFFA + K + VYT+SKDGA+FTW L E Sbjct: 173 KGLGG--KPFLFLGHRAAVVGAFFATDKKTGRVHGVYTVSKDGAIFTWNLVE 222