BLASTX nr result
ID: Dioscorea21_contig00030763
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00030763 (309 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EGC42647.1| transcript antisense to ribosomal RNA protein [Aj... 48 1e-11 gb|EGU85250.1| hypothetical protein FOXB_04271 [Fusarium oxyspor... 63 2e-08 >gb|EGC42647.1| transcript antisense to ribosomal RNA protein [Ajellomyces capsulatus H88] Length = 199 Score = 48.1 bits (113), Expect(3) = 1e-11 Identities = 27/39 (69%), Positives = 28/39 (71%), Gaps = 2/39 (5%) Frame = -2 Query: 308 PF*AAFPNYSTRRRSFTEIWHPT--RRGSHPLWRPVPGN 198 PF AAFPN STRRRSFT P RR SHPL RPVPG+ Sbjct: 27 PFGAAFPNNSTRRRSFTRA-RPAGRRRDSHPLRRPVPGD 64 Score = 38.5 bits (88), Expect(3) = 1e-11 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = -3 Query: 121 VLPLHSPLLGQSLLVSFPPHIN 56 +LPLHSPLL QSLLVSFPP I+ Sbjct: 91 LLPLHSPLLRQSLLVSFPPLID 112 Score = 26.9 bits (58), Expect(3) = 1e-11 Identities = 17/28 (60%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = -1 Query: 201 ELGRHRIKSILYKLQL-GL*EPDFKFEL 121 +L R R +SIL KLQL PDFKFEL Sbjct: 64 DLDRGRARSILCKLQLRPPGGPDFKFEL 91 >gb|EGU85250.1| hypothetical protein FOXB_04271 [Fusarium oxysporum Fo5176] Length = 634 Score = 63.2 bits (152), Expect = 2e-08 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -3 Query: 271 EGALQRFGIRPDGALTLYGVPFQGTRKAPHQKHP 170 E ALQ G +PDGALTLYGVPFQGTRKAPHQKHP Sbjct: 427 EEALQGSGNQPDGALTLYGVPFQGTRKAPHQKHP 460