BLASTX nr result
ID: Dioscorea21_contig00030706
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00030706 (242 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAG43553.1|AF211535_1 Avr9/Cf-9 rapidly elicited protein 194 ... 65 7e-09 ref|XP_002299484.1| predicted protein [Populus trichocarpa] gi|2... 62 6e-08 ref|XP_002509936.1| conserved hypothetical protein [Ricinus comm... 57 1e-06 gb|AAG51712.1|AC066689_11 hypothetical protein; 65549-64619 [Ara... 56 3e-06 ref|XP_003538678.1| PREDICTED: uncharacterized protein LOC100777... 56 3e-06 >gb|AAG43553.1|AF211535_1 Avr9/Cf-9 rapidly elicited protein 194 [Nicotiana tabacum] Length = 155 Score = 64.7 bits (156), Expect = 7e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +1 Query: 139 LWDCGSSLYDSFELKAFNKQLDSAIASRSLSMP 237 +WDCGSSLYDSFELK+F +QLDSAIASRSLSMP Sbjct: 9 IWDCGSSLYDSFELKSFERQLDSAIASRSLSMP 41 >ref|XP_002299484.1| predicted protein [Populus trichocarpa] gi|222846742|gb|EEE84289.1| predicted protein [Populus trichocarpa] Length = 142 Score = 61.6 bits (148), Expect = 6e-08 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +1 Query: 136 MLWDCGSSLYDSFELKAFNKQLDSAIASRSLSMP 237 ++WDCGSSLYDSFELK+F +QLDSAI SR+LSMP Sbjct: 8 LVWDCGSSLYDSFELKSFERQLDSAINSRTLSMP 41 >ref|XP_002509936.1| conserved hypothetical protein [Ricinus communis] gi|223549835|gb|EEF51323.1| conserved hypothetical protein [Ricinus communis] Length = 182 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = +1 Query: 109 ERAQQVKNNMLWDCGSSLYDSFELKAFNKQLDSAIASRSLSMP 237 + Q + +WDCGS+LYDSFELK+F +QL SAI SR+LSMP Sbjct: 27 QEQQHRRKAFVWDCGSTLYDSFELKSFERQLCSAIHSRTLSMP 69 >gb|AAG51712.1|AC066689_11 hypothetical protein; 65549-64619 [Arabidopsis thaliana] Length = 265 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/41 (63%), Positives = 35/41 (85%), Gaps = 2/41 (4%) Frame = +1 Query: 121 QVKNNMLWDCGSSLYDSFELKAFNKQLDSAIAS--RSLSMP 237 ++KN +WDC S+LYDSFEL +FN+QL+SAI+S RS+SMP Sbjct: 116 KMKNRKVWDCESTLYDSFELNSFNRQLNSAISSSARSMSMP 156 >ref|XP_003538678.1| PREDICTED: uncharacterized protein LOC100777768 [Glycine max] Length = 228 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/40 (67%), Positives = 33/40 (82%), Gaps = 4/40 (10%) Frame = +1 Query: 130 NNMLWDCGSSLYDSFELKAFNKQLDSAIA----SRSLSMP 237 +N +WDCGS+LYDSFEL +F +QLDSAIA SR+LSMP Sbjct: 75 SNNVWDCGSTLYDSFELNSFKRQLDSAIANSPISRTLSMP 114