BLASTX nr result
ID: Dioscorea21_contig00030688
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00030688 (238 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003545736.1| PREDICTED: uncharacterized protein LOC100806... 39 8e-06 >ref|XP_003545736.1| PREDICTED: uncharacterized protein LOC100806549 [Glycine max] Length = 418 Score = 38.9 bits (89), Expect(2) = 8e-06 Identities = 18/46 (39%), Positives = 30/46 (65%), Gaps = 4/46 (8%) Frame = +3 Query: 81 LDNLTVNENVEDDIENI----TAIEPTDEWTQFRHNMAVDMFNTWR 206 +DN +N+ +E NI T I+ T+EWT+FR +A++MF T++ Sbjct: 367 VDNELINQQMERVTNNIGDEVTTIQATEEWTRFRDTLAMNMFATYQ 412 Score = 35.4 bits (80), Expect(2) = 8e-06 Identities = 16/23 (69%), Positives = 17/23 (73%) Frame = +1 Query: 1 QQRIINACCLLHNFIRREMVEDP 69 Q RIINAC +LHNFIR E DP Sbjct: 332 QIRIINACFMLHNFIRDEQHSDP 354