BLASTX nr result
ID: Dioscorea21_contig00030571
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00030571 (223 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EAZ01332.1| hypothetical protein OsI_23363 [Oryza sativa Indi... 55 5e-06 >gb|EAZ01332.1| hypothetical protein OsI_23363 [Oryza sativa Indica Group] Length = 897 Score = 55.5 bits (132), Expect = 5e-06 Identities = 23/35 (65%), Positives = 31/35 (88%) Frame = +1 Query: 1 AYMQEIEMVFKLGMLCTGRTPSMRPTMKEVLQVLE 105 AY+QE+++VFKLG++CTG P RP+MKEVLQVL+ Sbjct: 862 AYLQEVQLVFKLGLICTGAKPLSRPSMKEVLQVLQ 896