BLASTX nr result
ID: Dioscorea21_contig00030555
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00030555 (397 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEJ84000.1| CONSTANS protein [Nicotiana tabacum] 62 5e-08 emb|CAP09655.1| CONSTANS protein [Solanum tuberosum subsp. andig... 62 5e-08 gb|ABF56053.2| CONSTANS [Solanum tuberosum] 62 5e-08 ref|XP_004167377.1| PREDICTED: zinc finger protein CONSTANS-LIKE... 62 6e-08 ref|XP_004146352.1| PREDICTED: zinc finger protein CONSTANS-LIKE... 62 6e-08 >gb|AEJ84000.1| CONSTANS protein [Nicotiana tabacum] Length = 403 Score = 62.0 bits (149), Expect = 5e-08 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 4/49 (8%) Frame = +1 Query: 70 YASRKAYAETRPRIKGRFAKRTDVAEPVPDPVY----FFDPSYGVVPSF 204 YASRKAYAETRPRIKGRFAKRTDV V D ++ D SYG+VPSF Sbjct: 356 YASRKAYAETRPRIKGRFAKRTDVEAEV-DQMFSTQLIADSSYGIVPSF 403 >emb|CAP09655.1| CONSTANS protein [Solanum tuberosum subsp. andigenum] Length = 410 Score = 62.0 bits (149), Expect = 5e-08 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 4/49 (8%) Frame = +1 Query: 70 YASRKAYAETRPRIKGRFAKRTDVAEPVPDPVY----FFDPSYGVVPSF 204 YASRKAYAETRPRIKGRFAKRTDV V D ++ D SYG+VPSF Sbjct: 363 YASRKAYAETRPRIKGRFAKRTDVEAEV-DQMFSTQLMTDSSYGIVPSF 410 >gb|ABF56053.2| CONSTANS [Solanum tuberosum] Length = 413 Score = 62.0 bits (149), Expect = 5e-08 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 4/49 (8%) Frame = +1 Query: 70 YASRKAYAETRPRIKGRFAKRTDVAEPVPDPVY----FFDPSYGVVPSF 204 YASRKAYAETRPRIKGRFAKRTDV V D ++ D SYG+VPSF Sbjct: 366 YASRKAYAETRPRIKGRFAKRTDVKAEV-DQMFSTQLMTDSSYGIVPSF 413 >ref|XP_004167377.1| PREDICTED: zinc finger protein CONSTANS-LIKE 5-like [Cucumis sativus] Length = 375 Score = 61.6 bits (148), Expect = 6e-08 Identities = 32/52 (61%), Positives = 36/52 (69%), Gaps = 7/52 (13%) Frame = +1 Query: 70 YASRKAYAETRPRIKGRFAKRTDVAEPVPD-------PVYFFDPSYGVVPSF 204 YASRKAYAETRPRIKGRFAKRTD+ V + V+ D YGVVP+F Sbjct: 324 YASRKAYAETRPRIKGRFAKRTDMLSEVDEIYGSAASSVFLTDAQYGVVPTF 375 >ref|XP_004146352.1| PREDICTED: zinc finger protein CONSTANS-LIKE 5-like [Cucumis sativus] Length = 322 Score = 61.6 bits (148), Expect = 6e-08 Identities = 32/52 (61%), Positives = 36/52 (69%), Gaps = 7/52 (13%) Frame = +1 Query: 70 YASRKAYAETRPRIKGRFAKRTDVAEPVPD-------PVYFFDPSYGVVPSF 204 YASRKAYAETRPRIKGRFAKRTD+ V + V+ D YGVVP+F Sbjct: 271 YASRKAYAETRPRIKGRFAKRTDMLSEVDEIYGSAASSVFLTDAQYGVVPTF 322