BLASTX nr result
ID: Dioscorea21_contig00030493
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00030493 (322 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511542.1| pentatricopeptide repeat-containing protein,... 74 1e-11 ref|XP_002267998.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 >ref|XP_002511542.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223550657|gb|EEF52144.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 434 Score = 74.3 bits (181), Expect = 1e-11 Identities = 35/79 (44%), Positives = 50/79 (63%) Frame = +3 Query: 81 HALIVTSQPSIFPLFLKLVSAPATIHYAHQVFDVIPQPDPLFSNSIISIFSKLSLHQDAI 260 H+LI+ PS+ + ++ + + I YA Q+FD +PQP + NS+IS +SKLSLH+DA+ Sbjct: 22 HSLIIIKHPSLATVLVRKLLNLSDIDYARQLFDQVPQPGQILYNSLISTYSKLSLHKDAL 81 Query: 261 NVFFSAHRKGTELLFFTVP 317 FFS H T L FT P Sbjct: 82 KTFFSMHHSDTRLSCFTGP 100 >ref|XP_002267998.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Vitis vinifera] Length = 618 Score = 63.5 bits (153), Expect = 2e-08 Identities = 31/78 (39%), Positives = 47/78 (60%) Frame = +3 Query: 84 ALIVTSQPSIFPLFLKLVSAPATIHYAHQVFDVIPQPDPLFSNSIISIFSKLSLHQDAIN 263 ALI+ S+ PLF++ + + I YA QVFD IP PD S I+ +S+LSL+ +A+ Sbjct: 23 ALIIIKYLSLTPLFIRRLLNASFIQYARQVFDQIPHPDQGVHCSFITAYSRLSLNNEALR 82 Query: 264 VFFSAHRKGTELLFFTVP 317 F S H+ ++ FT+P Sbjct: 83 TFVSMHQNNVRIVCFTIP 100