BLASTX nr result
ID: Dioscorea21_contig00030294
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00030294 (218 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532038.1| conserved hypothetical protein [Ricinus comm... 60 2e-07 ref|XP_003581429.1| PREDICTED: uncharacterized protein LOC100821... 58 7e-07 emb|CBI37128.3| unnamed protein product [Vitis vinifera] 58 9e-07 ref|XP_002277848.1| PREDICTED: uncharacterized protein LOC100244... 58 9e-07 gb|ABK21716.1| unknown [Picea sitchensis] 58 9e-07 >ref|XP_002532038.1| conserved hypothetical protein [Ricinus communis] gi|223528308|gb|EEF30354.1| conserved hypothetical protein [Ricinus communis] Length = 169 Score = 59.7 bits (143), Expect = 2e-07 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = -2 Query: 112 TITSSEPNMDNSSRPSRYESQKRRDWNTFGQYLKNHR 2 +I +S + +SS PSRYE+QKRRDWNTFGQYLKNHR Sbjct: 32 SIGTSSSSPSSSSTPSRYENQKRRDWNTFGQYLKNHR 68 >ref|XP_003581429.1| PREDICTED: uncharacterized protein LOC100821276 [Brachypodium distachyon] Length = 209 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/39 (66%), Positives = 34/39 (87%), Gaps = 1/39 (2%) Frame = -2 Query: 115 NTITSSEPNMDNSSR-PSRYESQKRRDWNTFGQYLKNHR 2 ++ITSS ++ N+ + PSRYE+QKRRDWNTFGQYL+NHR Sbjct: 30 SSITSSPSSVGNTPQSPSRYEAQKRRDWNTFGQYLRNHR 68 >emb|CBI37128.3| unnamed protein product [Vitis vinifera] Length = 246 Score = 57.8 bits (138), Expect = 9e-07 Identities = 28/42 (66%), Positives = 32/42 (76%), Gaps = 3/42 (7%) Frame = -2 Query: 118 INTITSSEPNMDNSSR---PSRYESQKRRDWNTFGQYLKNHR 2 INT ++S +SS PSRYE+QKRRDWNTFGQYLKNHR Sbjct: 126 INTSSNSSAATSSSSASTTPSRYENQKRRDWNTFGQYLKNHR 167 >ref|XP_002277848.1| PREDICTED: uncharacterized protein LOC100244642 [Vitis vinifera] Length = 183 Score = 57.8 bits (138), Expect = 9e-07 Identities = 28/42 (66%), Positives = 32/42 (76%), Gaps = 3/42 (7%) Frame = -2 Query: 118 INTITSSEPNMDNSSR---PSRYESQKRRDWNTFGQYLKNHR 2 INT ++S +SS PSRYE+QKRRDWNTFGQYLKNHR Sbjct: 17 INTSSNSSAATSSSSASTTPSRYENQKRRDWNTFGQYLKNHR 58 >gb|ABK21716.1| unknown [Picea sitchensis] Length = 226 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/38 (68%), Positives = 27/38 (71%) Frame = -2 Query: 115 NTITSSEPNMDNSSRPSRYESQKRRDWNTFGQYLKNHR 2 N I + S PSRYESQKRRDWNTFGQYLKNHR Sbjct: 26 NGINEGSRELAASPAPSRYESQKRRDWNTFGQYLKNHR 63