BLASTX nr result
ID: Dioscorea21_contig00030279
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00030279 (233 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002315835.1| predicted protein [Populus trichocarpa] gi|2... 64 2e-08 gb|ABK94624.1| unknown [Populus trichocarpa] 64 2e-08 ref|XP_002521890.1| peptide transporter, putative [Ricinus commu... 60 1e-07 emb|CBI26754.3| unnamed protein product [Vitis vinifera] 59 5e-07 ref|XP_002285274.1| PREDICTED: peptide transporter PTR2-like [Vi... 59 5e-07 >ref|XP_002315835.1| predicted protein [Populus trichocarpa] gi|222864875|gb|EEF02006.1| predicted protein [Populus trichocarpa] Length = 584 Score = 63.5 bits (153), Expect = 2e-08 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -3 Query: 99 SGDGSVDINGNPALRYQTGNWKSCLYILGTECC 1 +GDGSVDINGNP L+ +TGNWK+C +ILGTECC Sbjct: 26 TGDGSVDINGNPVLKQKTGNWKACPFILGTECC 58 >gb|ABK94624.1| unknown [Populus trichocarpa] Length = 133 Score = 63.5 bits (153), Expect = 2e-08 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -3 Query: 99 SGDGSVDINGNPALRYQTGNWKSCLYILGTECC 1 +GDGSVDINGNP L+ +TGNWK+C +ILGTECC Sbjct: 26 TGDGSVDINGNPVLKQKTGNWKACPFILGTECC 58 >ref|XP_002521890.1| peptide transporter, putative [Ricinus communis] gi|223538928|gb|EEF40526.1| peptide transporter, putative [Ricinus communis] Length = 585 Score = 60.5 bits (145), Expect = 1e-07 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = -3 Query: 99 SGDGSVDINGNPALRYQTGNWKSCLYILGTECC 1 +GDGSVD+ GNP L+ +TGNWK+C +ILGTECC Sbjct: 26 TGDGSVDLKGNPVLKQKTGNWKACPFILGTECC 58 >emb|CBI26754.3| unnamed protein product [Vitis vinifera] Length = 482 Score = 58.5 bits (140), Expect = 5e-07 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = -3 Query: 99 SGDGSVDINGNPALRYQTGNWKSCLYILGTECC 1 +GDGSVDI+G P LR TGNW++C +ILGTECC Sbjct: 27 TGDGSVDIHGKPVLRSNTGNWRACPFILGTECC 59 >ref|XP_002285274.1| PREDICTED: peptide transporter PTR2-like [Vitis vinifera] Length = 586 Score = 58.5 bits (140), Expect = 5e-07 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = -3 Query: 99 SGDGSVDINGNPALRYQTGNWKSCLYILGTECC 1 +GDGSVDI+G P LR TGNW++C +ILGTECC Sbjct: 27 TGDGSVDIHGKPVLRSNTGNWRACPFILGTECC 59