BLASTX nr result
ID: Dioscorea21_contig00030266
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00030266 (215 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI83256.1| basic helix-loop-helix transcription factor [Hum... 80 2e-13 ref|XP_004136191.1| PREDICTED: transcription factor bHLH94-like ... 79 3e-13 ref|XP_002278824.1| PREDICTED: transcription factor bHLH71 [Viti... 79 4e-13 ref|XP_002527666.1| DNA binding protein, putative [Ricinus commu... 78 6e-13 gb|AEW69789.1| Hop-interacting protein THI018 [Solanum lycopersi... 77 1e-12 >emb|CBI83256.1| basic helix-loop-helix transcription factor [Humulus lupulus] Length = 318 Score = 79.7 bits (195), Expect = 2e-13 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = +1 Query: 91 NKEEAETQRMTHIAVERNRRRQMNEHLSVLRSLMPDCYIQR 213 NKEEAETQRMTHIAVERNRR+QMNEHL+VLRSLMPD Y+QR Sbjct: 93 NKEEAETQRMTHIAVERNRRKQMNEHLAVLRSLMPDSYVQR 133 >ref|XP_004136191.1| PREDICTED: transcription factor bHLH94-like [Cucumis sativus] Length = 321 Score = 79.3 bits (194), Expect = 3e-13 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = +1 Query: 91 NKEEAETQRMTHIAVERNRRRQMNEHLSVLRSLMPDCYIQR 213 NKEEAETQRMTHIAVERNRR+QMNEHLSVLRSLMP+ Y+QR Sbjct: 98 NKEEAETQRMTHIAVERNRRKQMNEHLSVLRSLMPESYVQR 138 >ref|XP_002278824.1| PREDICTED: transcription factor bHLH71 [Vitis vinifera] Length = 315 Score = 79.0 bits (193), Expect = 4e-13 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = +1 Query: 91 NKEEAETQRMTHIAVERNRRRQMNEHLSVLRSLMPDCYIQR 213 NKEEAETQRMTHIAVERNRRRQMNEHL++LRSLMP+ Y+QR Sbjct: 91 NKEEAETQRMTHIAVERNRRRQMNEHLAILRSLMPESYVQR 131 >ref|XP_002527666.1| DNA binding protein, putative [Ricinus communis] gi|223532971|gb|EEF34737.1| DNA binding protein, putative [Ricinus communis] Length = 275 Score = 78.2 bits (191), Expect = 6e-13 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = +1 Query: 91 NKEEAETQRMTHIAVERNRRRQMNEHLSVLRSLMPDCYIQR 213 NKEEAETQRMTHIAVERNRR+QMNEHL+VLRSLMP+ Y+QR Sbjct: 94 NKEEAETQRMTHIAVERNRRKQMNEHLAVLRSLMPESYVQR 134 >gb|AEW69789.1| Hop-interacting protein THI018 [Solanum lycopersicum] Length = 328 Score = 77.4 bits (189), Expect = 1e-12 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = +1 Query: 91 NKEEAETQRMTHIAVERNRRRQMNEHLSVLRSLMPDCYIQR 213 NKEEAE QRMTHIAVERNRR+QMNEHLSVLRSLMP+ Y+QR Sbjct: 109 NKEEAENQRMTHIAVERNRRKQMNEHLSVLRSLMPESYVQR 149