BLASTX nr result
ID: Dioscorea21_contig00030118
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00030118 (308 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002265018.1| PREDICTED: kelch repeat-containing protein A... 63 3e-08 tpg|DAA37243.1| TPA: Kelch motif protein family, partial [Zea mays] 59 5e-07 ref|NP_001152405.1| kelch motif family protein [Zea mays] gi|194... 59 5e-07 ref|XP_002446697.1| hypothetical protein SORBIDRAFT_06g020730 [S... 57 1e-06 ref|NP_175565.2| kelch-like motif-containing protein [Arabidopsi... 57 2e-06 >ref|XP_002265018.1| PREDICTED: kelch repeat-containing protein At3g27220 [Vitis vinifera] gi|297735771|emb|CBI18458.3| unnamed protein product [Vitis vinifera] Length = 426 Score = 62.8 bits (151), Expect = 3e-08 Identities = 35/63 (55%), Positives = 39/63 (61%) Frame = -2 Query: 289 VFQFNLGSLYQLMVRKLSFSRQDYLGRVLEC*LYFTSRQRDSSPFDPALKKVTGNMWRTK 110 VFQFNL SL ++ KL + + L LYFTS QRD P DPA KKV G MWRTK Sbjct: 364 VFQFNLDSLKWSVIGKLPYRVKTTLAGFWNGWLYFTSGQRDKGPDDPAPKKVLGEMWRTK 423 Query: 109 LSL 101 LSL Sbjct: 424 LSL 426 >tpg|DAA37243.1| TPA: Kelch motif protein family, partial [Zea mays] Length = 434 Score = 58.5 bits (140), Expect = 5e-07 Identities = 32/63 (50%), Positives = 40/63 (63%) Frame = -2 Query: 289 VFQFNLGSLYQLMVRKLSFSRQDYLGRVLEC*LYFTSRQRDSSPFDPALKKVTGNMWRTK 110 VF+FNLG+L ++ +L F + L + LYFTS QRD P DP+ KKV G MWRTK Sbjct: 354 VFRFNLGTLEWSVIGRLPFRIKTTLVGYWDGWLYFTSGQRDKGPKDPSPKKVVGCMWRTK 413 Query: 109 LSL 101 L L Sbjct: 414 LHL 416 >ref|NP_001152405.1| kelch motif family protein [Zea mays] gi|194694236|gb|ACF81202.1| unknown [Zea mays] gi|194700292|gb|ACF84230.1| unknown [Zea mays] gi|195655923|gb|ACG47429.1| kelch motif family protein [Zea mays] gi|414586671|tpg|DAA37242.1| TPA: Kelch motif protein family [Zea mays] Length = 416 Score = 58.5 bits (140), Expect = 5e-07 Identities = 32/63 (50%), Positives = 40/63 (63%) Frame = -2 Query: 289 VFQFNLGSLYQLMVRKLSFSRQDYLGRVLEC*LYFTSRQRDSSPFDPALKKVTGNMWRTK 110 VF+FNLG+L ++ +L F + L + LYFTS QRD P DP+ KKV G MWRTK Sbjct: 354 VFRFNLGTLEWSVIGRLPFRIKTTLVGYWDGWLYFTSGQRDKGPKDPSPKKVVGCMWRTK 413 Query: 109 LSL 101 L L Sbjct: 414 LHL 416 >ref|XP_002446697.1| hypothetical protein SORBIDRAFT_06g020730 [Sorghum bicolor] gi|241937880|gb|EES11025.1| hypothetical protein SORBIDRAFT_06g020730 [Sorghum bicolor] Length = 416 Score = 57.4 bits (137), Expect = 1e-06 Identities = 32/63 (50%), Positives = 39/63 (61%) Frame = -2 Query: 289 VFQFNLGSLYQLMVRKLSFSRQDYLGRVLEC*LYFTSRQRDSSPFDPALKKVTGNMWRTK 110 VFQFNL +L ++ +L F + L + LYFTS QRD P DP+ KKV G MWRTK Sbjct: 354 VFQFNLDTLEWSVIGRLPFRIKTTLVGYWDGWLYFTSGQRDKGPKDPSPKKVVGCMWRTK 413 Query: 109 LSL 101 L L Sbjct: 414 LHL 416 >ref|NP_175565.2| kelch-like motif-containing protein [Arabidopsis thaliana] gi|28416695|gb|AAO42878.1| At1g51540 [Arabidopsis thaliana] gi|110743235|dbj|BAE99508.1| At1g51540 [Arabidopsis thaliana] gi|332194560|gb|AEE32681.1| kelch-like motif-containing protein [Arabidopsis thaliana] Length = 415 Score = 57.0 bits (136), Expect = 2e-06 Identities = 30/63 (47%), Positives = 38/63 (60%) Frame = -2 Query: 289 VFQFNLGSLYQLMVRKLSFSRQDYLGRVLEC*LYFTSRQRDSSPFDPALKKVTGNMWRTK 110 +FQFNL +L ++ KL + + L + LYFTS QRD P DPA +KV MWRTK Sbjct: 351 IFQFNLNTLKWYVIGKLPYRVKTTLAGYWDGQLYFTSGQRDKGPDDPAPRKVMAEMWRTK 410 Query: 109 LSL 101 L L Sbjct: 411 LIL 413