BLASTX nr result
ID: Dioscorea21_contig00029712
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00029712 (456 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530050.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 >ref|XP_002530050.1| conserved hypothetical protein [Ricinus communis] gi|223530466|gb|EEF32350.1| conserved hypothetical protein [Ricinus communis] Length = 607 Score = 55.8 bits (133), Expect = 3e-06 Identities = 28/57 (49%), Positives = 38/57 (66%) Frame = -2 Query: 326 NEWKEIKQALDEKKEQLLKTDXXXXXXXXXXXXXSYRAVRGSALGPTIALLRAENDL 156 N W+EI +AL+ KK +L + D SY+A+RGSALGPT+ALLRA+N+L Sbjct: 551 NAWEEISEALNAKKAELAQEDNWNKPGSSGRRPWSYKALRGSALGPTMALLRAQNEL 607