BLASTX nr result
ID: Dioscorea21_contig00029624
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00029624 (302 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACV92008.1| WRKY transcription factor 6 [(Populus tomentosa x... 55 8e-06 >gb|ACV92008.1| WRKY transcription factor 6 [(Populus tomentosa x P. bolleana) x P. tomentosa] Length = 369 Score = 54.7 bits (130), Expect = 8e-06 Identities = 39/123 (31%), Positives = 59/123 (47%), Gaps = 25/123 (20%) Frame = -3 Query: 297 RCLLDELN*AQGLARQLQASLGHPSTIPVCKNLAQEILSCIEKAVSLAKPSSLEDY---- 130 + L+ EL+ + LA+QL L S++ + L +ILS EKA+SL +L D Sbjct: 10 KTLISELSQGKELAKQLSNHLNPSSSLEARQFLVDKILSSYEKALSLLNWGALVDQQPKP 69 Query: 129 ------------------EISEQRTNEQKRRDLTKRRKALPTWTKLVRVSEGQGSE---E 13 E+S+Q E+ +D+ K+RK P WT+ V+V G G E + Sbjct: 70 TIGTVEPLHSLANSSPRSEVSDQDCKEECNKDVYKKRKIQPRWTEQVKVCSGTGLEGPLD 129 Query: 12 DGY 4 DGY Sbjct: 130 DGY 132