BLASTX nr result
ID: Dioscorea21_contig00029026
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00029026 (262 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534273.1| cysteine-type peptidase, putative [Ricinus c... 63 2e-08 ref|XP_002323302.1| predicted protein [Populus trichocarpa] gi|2... 63 2e-08 ref|XP_004136582.1| PREDICTED: OTU domain-containing protein At3... 62 4e-08 ref|XP_002514949.1| OTU domain-containing protein 6B, putative [... 60 1e-07 dbj|BAJ95611.1| predicted protein [Hordeum vulgare subsp. vulgare] 59 3e-07 >ref|XP_002534273.1| cysteine-type peptidase, putative [Ricinus communis] gi|223525596|gb|EEF28110.1| cysteine-type peptidase, putative [Ricinus communis] Length = 343 Score = 63.2 bits (152), Expect = 2e-08 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = -1 Query: 112 LSGITGDGRCLFRSVAHGAYLRSGKPSPSEHLQKQLA 2 ++GI GDGRCLFRSVAHGA LR+GKP+PSE LQ++LA Sbjct: 198 ITGIPGDGRCLFRSVAHGASLRTGKPAPSESLQRELA 234 >ref|XP_002323302.1| predicted protein [Populus trichocarpa] gi|222867932|gb|EEF05063.1| predicted protein [Populus trichocarpa] Length = 319 Score = 63.2 bits (152), Expect = 2e-08 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = -1 Query: 106 GITGDGRCLFRSVAHGAYLRSGKPSPSEHLQKQLA 2 GI GDGRCLFRSVAHGA +RSGKP+PSE+LQ++LA Sbjct: 176 GIPGDGRCLFRSVAHGACIRSGKPAPSENLQRELA 210 >ref|XP_004136582.1| PREDICTED: OTU domain-containing protein At3g57810-like [Cucumis sativus] gi|449522883|ref|XP_004168455.1| PREDICTED: OTU domain-containing protein At3g57810-like [Cucumis sativus] Length = 286 Score = 62.4 bits (150), Expect = 4e-08 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -1 Query: 106 GITGDGRCLFRSVAHGAYLRSGKPSPSEHLQKQLA 2 GI GDGRCLFRSVAHGA LRSGKP+PSE LQ+ LA Sbjct: 142 GIPGDGRCLFRSVAHGACLRSGKPAPSESLQRDLA 176 >ref|XP_002514949.1| OTU domain-containing protein 6B, putative [Ricinus communis] gi|223546000|gb|EEF47503.1| OTU domain-containing protein 6B, putative [Ricinus communis] Length = 167 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -1 Query: 109 SGITGDGRCLFRSVAHGAYLRSGKPSPSEHLQKQLA 2 +GI GDGRCLFRSV HGA LR GKPSP+E L+K+LA Sbjct: 24 TGIPGDGRCLFRSVVHGACLREGKPSPTESLEKELA 59 >dbj|BAJ95611.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 310 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = -1 Query: 112 LSGITGDGRCLFRSVAHGAYLRSGKPSPSEHLQKQLA 2 ++GI GDGRCLFRSVAHG +RSGKP P+E+LQ++LA Sbjct: 165 VTGIPGDGRCLFRSVAHGECIRSGKPIPNENLQRKLA 201