BLASTX nr result
ID: Dioscorea21_contig00028738
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00028738 (289 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001151226.1| protein aq_1857 [Zea mays] gi|195645154|gb|A... 55 8e-06 >ref|NP_001151226.1| protein aq_1857 [Zea mays] gi|195645154|gb|ACG42045.1| protein aq_1857 [Zea mays] gi|414870630|tpg|DAA49187.1| TPA: hypothetical protein ZEAMMB73_025811 [Zea mays] Length = 158 Score = 54.7 bits (130), Expect = 8e-06 Identities = 34/73 (46%), Positives = 48/73 (65%), Gaps = 7/73 (9%) Frame = -1 Query: 199 MSRLVLQRLTASIYFRIKQNYRLLG----TSAVESSSSLDAE-EAVHMTENCIQRLKELH 35 +SR +L+R+ R++ N+R+L T+A+E +S L AE +AV MTE C++RLKELH Sbjct: 5 LSRALLRRVAELARGRLRANHRMLSSASSTAAIERASQLPAEAQAVRMTEGCVRRLKELH 64 Query: 34 AK--GEFDKMLRL 2 AK KMLRL Sbjct: 65 AKKPSAEGKMLRL 77