BLASTX nr result
ID: Dioscorea21_contig00028608
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00028608 (222 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002326915.1| predicted protein [Populus trichocarpa] gi|2... 46 8e-06 >ref|XP_002326915.1| predicted protein [Populus trichocarpa] gi|222835230|gb|EEE73665.1| predicted protein [Populus trichocarpa] Length = 398 Score = 45.8 bits (107), Expect(2) = 8e-06 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = +1 Query: 1 KRLKPVTVRKLKRPLVAYDSMSWSNLMSNISF 96 ++LKPV V+K+ RP +A DS SWSNLMSNISF Sbjct: 349 EKLKPVIVKKV-RPFIAVDSASWSNLMSNISF 379 Score = 28.5 bits (62), Expect(2) = 8e-06 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = +2 Query: 110 SYVVPSEALTLDVKW 154 S +VP EALTLDVKW Sbjct: 384 SVLVPPEALTLDVKW 398