BLASTX nr result
ID: Dioscorea21_contig00028351
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00028351 (256 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281507.1| PREDICTED: IAA-amino acid hydrolase ILR1-lik... 55 5e-06 ref|XP_002882255.1| IAA amidohydrolase [Arabidopsis lyrata subsp... 55 6e-06 >ref|XP_002281507.1| PREDICTED: IAA-amino acid hydrolase ILR1-like [Vitis vinifera] Length = 438 Score = 55.5 bits (132), Expect = 5e-06 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -1 Query: 244 LHSPYLFVDEQALPVGAAMYAAVAMSYLERHSAE 143 LHSPY F+DE A PVGAA YAAVA+SYL+ H+ E Sbjct: 398 LHSPYFFIDEDAFPVGAAFYAAVAISYLDDHAVE 431 >ref|XP_002882255.1| IAA amidohydrolase [Arabidopsis lyrata subsp. lyrata] gi|297328095|gb|EFH58514.1| IAA amidohydrolase [Arabidopsis lyrata subsp. lyrata] Length = 442 Score = 55.1 bits (131), Expect = 6e-06 Identities = 23/31 (74%), Positives = 30/31 (96%) Frame = -1 Query: 244 LHSPYLFVDEQALPVGAAMYAAVAMSYLERH 152 LHSPY FVDE+ALPVGAA++AA+A+SYL++H Sbjct: 400 LHSPYFFVDEEALPVGAALHAAMAVSYLDKH 430