BLASTX nr result
ID: Dioscorea21_contig00028261
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00028261 (227 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278390.1| PREDICTED: pentatricopeptide repeat-containi... 55 6e-06 emb|CAN67320.1| hypothetical protein VITISV_039345 [Vitis vinifera] 55 6e-06 >ref|XP_002278390.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17033 [Vitis vinifera] gi|297744557|emb|CBI37819.3| unnamed protein product [Vitis vinifera] Length = 435 Score = 55.1 bits (131), Expect = 6e-06 Identities = 22/49 (44%), Positives = 38/49 (77%) Frame = +1 Query: 1 WIQGMKRTKIGYSVRTFNTVLNSCPVIVSMVHNLRCLPLSIGKFVEMVK 147 W+Q MK + I +S+RT+N+VLNSCP+I+S++ +L+ P +I + +E +K Sbjct: 267 WLQRMKNSSIPFSIRTYNSVLNSCPMIMSILQDLKTFPPTIDELMETLK 315 >emb|CAN67320.1| hypothetical protein VITISV_039345 [Vitis vinifera] Length = 371 Score = 55.1 bits (131), Expect = 6e-06 Identities = 22/49 (44%), Positives = 38/49 (77%) Frame = +1 Query: 1 WIQGMKRTKIGYSVRTFNTVLNSCPVIVSMVHNLRCLPLSIGKFVEMVK 147 W+Q MK + I +S+RT+N+VLNSCP+I+S++ +L+ P +I + +E +K Sbjct: 203 WLQRMKNSSIPFSIRTYNSVLNSCPMIMSILQDLKTFPPTIDELMETLK 251