BLASTX nr result
ID: Dioscorea21_contig00028207
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00028207 (366 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528258.1| conserved hypothetical protein [Ricinus comm... 55 6e-06 >ref|XP_002528258.1| conserved hypothetical protein [Ricinus communis] gi|223532295|gb|EEF34096.1| conserved hypothetical protein [Ricinus communis] Length = 1783 Score = 55.1 bits (131), Expect = 6e-06 Identities = 38/117 (32%), Positives = 57/117 (48%), Gaps = 7/117 (5%) Frame = +2 Query: 35 QEKRAAVSQSIRS--KTALEPVMKYLKISDIFFKSSPCFXXXXXXXXXXXWERGGQYIQI 208 Q R + S++S + L+ +M+ ++ F S+P W+ QYI I Sbjct: 876 QSTRETSNGSLQSHKSSLLDALMQNIEKGGDFINSNPRLLVVVLDFLKALWQGAAQYINI 935 Query: 209 LEKIRSSEEFWGNLSLSISAKEIMSTSS-----ENLKGDEIQLAAYRYQCQATVLEI 364 LE ++S FW LS IS + TSS ENL + Q AY+Y+CQ+ +LEI Sbjct: 936 LESLKSFRLFWKKLSNCIS----LITSSERPVLENLTEKDAQSLAYKYRCQSVILEI 988