BLASTX nr result
ID: Dioscorea21_contig00028183
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00028183 (282 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|Q653V6.1|NRAM3_ORYSJ RecName: Full=Metal transporter Nramp3; ... 56 3e-06 ref|XP_002438846.1| hypothetical protein SORBIDRAFT_10g027130 [S... 54 1e-05 gb|AFW69006.1| hypothetical protein ZEAMMB73_198457 [Zea mays] 54 1e-05 ref|NP_001132120.1| uncharacterized protein LOC100193537 [Zea ma... 54 1e-05 ref|XP_002273263.1| PREDICTED: metal transporter Nramp6 [Vitis v... 54 1e-05 >sp|Q653V6.1|NRAM3_ORYSJ RecName: Full=Metal transporter Nramp3; Short=OsNramp3 gi|52076899|dbj|BAD45911.1| putative NRAMP metal ion transporter 1 [Oryza sativa Japonica Group] gi|125556462|gb|EAZ02068.1| hypothetical protein OsI_24146 [Oryza sativa Indica Group] gi|125598225|gb|EAZ38005.1| hypothetical protein OsJ_22349 [Oryza sativa Japonica Group] gi|215697845|dbj|BAG92038.1| unnamed protein product [Oryza sativa Japonica Group] Length = 550 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -2 Query: 281 LFKLPVWCGVLITGLSTLVFLLLQQFGVCIHVFFIPLL 168 LFK+PVWCGVLITGLSTL+ LLLQQ+GV F I +L Sbjct: 155 LFKIPVWCGVLITGLSTLMLLLLQQYGVRKLEFLIAIL 192 >ref|XP_002438846.1| hypothetical protein SORBIDRAFT_10g027130 [Sorghum bicolor] gi|241917069|gb|EER90213.1| hypothetical protein SORBIDRAFT_10g027130 [Sorghum bicolor] Length = 550 Score = 54.3 bits (129), Expect = 1e-05 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -2 Query: 281 LFKLPVWCGVLITGLSTLVFLLLQQFGVCIHVFFIPLL 168 LF++PVWCGVLITGLSTL+ LLLQQ+GV F I L Sbjct: 155 LFRIPVWCGVLITGLSTLMLLLLQQYGVRKLEFLIAFL 192 >gb|AFW69006.1| hypothetical protein ZEAMMB73_198457 [Zea mays] Length = 368 Score = 54.3 bits (129), Expect = 1e-05 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -2 Query: 281 LFKLPVWCGVLITGLSTLVFLLLQQFGVCIHVFFIPLL 168 LF++PVWCGVLITGLSTL+ LLLQQ+GV F I L Sbjct: 155 LFRIPVWCGVLITGLSTLMLLLLQQYGVRKLEFLIAFL 192 >ref|NP_001132120.1| uncharacterized protein LOC100193537 [Zea mays] gi|194693480|gb|ACF80824.1| unknown [Zea mays] gi|413934454|gb|AFW69005.1| hypothetical protein ZEAMMB73_198457 [Zea mays] Length = 550 Score = 54.3 bits (129), Expect = 1e-05 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -2 Query: 281 LFKLPVWCGVLITGLSTLVFLLLQQFGVCIHVFFIPLL 168 LF++PVWCGVLITGLSTL+ LLLQQ+GV F I L Sbjct: 155 LFRIPVWCGVLITGLSTLMLLLLQQYGVRKLEFLIAFL 192 >ref|XP_002273263.1| PREDICTED: metal transporter Nramp6 [Vitis vinifera] gi|297745101|emb|CBI38940.3| unnamed protein product [Vitis vinifera] Length = 541 Score = 54.3 bits (129), Expect = 1e-05 Identities = 26/38 (68%), Positives = 29/38 (76%) Frame = -2 Query: 281 LFKLPVWCGVLITGLSTLVFLLLQQFGVCIHVFFIPLL 168 LF +PVWCGVL+TGLSTLV L LQQ+GV FFI L Sbjct: 149 LFNIPVWCGVLLTGLSTLVLLALQQYGVRKLEFFIAFL 186