BLASTX nr result
ID: Dioscorea21_contig00027412
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00027412 (254 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGA83664.1| calcium-dependent protein kinase 1 [Dendrobium of... 105 3e-21 ref|XP_002518484.1| calcium-dependent protein kinase, putative [... 105 4e-21 ref|XP_003529633.1| PREDICTED: calcium-dependent protein kinase ... 102 4e-20 dbj|BAE71239.1| putative calcium dependent protein kinase [Trifo... 100 1e-19 ref|XP_003617547.1| Calcium dependent protein kinase [Medicago t... 100 1e-19 >gb|AGA83664.1| calcium-dependent protein kinase 1 [Dendrobium officinale] Length = 534 Score = 105 bits (263), Expect = 3e-21 Identities = 48/61 (78%), Positives = 57/61 (93%) Frame = -1 Query: 254 DNSGYITREELRSAMEEHGMGDAATIKEIISEVDTDNDGRINYEEFCAMMRSGVQQNVKV 75 D+SG+ITR+EL +A+EEHGMGDAATIKEIISEVD DNDGRINYEEFCAMM+SG+QQ K+ Sbjct: 474 DDSGFITRDELETALEEHGMGDAATIKEIISEVDADNDGRINYEEFCAMMKSGLQQPAKI 533 Query: 74 L 72 + Sbjct: 534 I 534 >ref|XP_002518484.1| calcium-dependent protein kinase, putative [Ricinus communis] gi|223542329|gb|EEF43871.1| calcium-dependent protein kinase, putative [Ricinus communis] Length = 551 Score = 105 bits (262), Expect = 4e-21 Identities = 50/60 (83%), Positives = 56/60 (93%) Frame = -1 Query: 254 DNSGYITREELRSAMEEHGMGDAATIKEIISEVDTDNDGRINYEEFCAMMRSGVQQNVKV 75 D+SGYITR+EL SAM+E+GMGD ATIKEIISEVDTDNDGRINYEEFCAMMRSG+QQ K+ Sbjct: 491 DSSGYITRDELESAMKEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGIQQAEKL 550 >ref|XP_003529633.1| PREDICTED: calcium-dependent protein kinase 21-like [Glycine max] Length = 529 Score = 102 bits (253), Expect = 4e-20 Identities = 48/61 (78%), Positives = 54/61 (88%) Frame = -1 Query: 254 DNSGYITREELRSAMEEHGMGDAATIKEIISEVDTDNDGRINYEEFCAMMRSGVQQNVKV 75 DNSGYITR+EL +AM +HGMGD ATIKEIISEVDTDNDGRINYEEFCAMMRSG+ ++ Sbjct: 469 DNSGYITRDELETAMTQHGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGMPHQGQL 528 Query: 74 L 72 L Sbjct: 529 L 529 >dbj|BAE71239.1| putative calcium dependent protein kinase [Trifolium pratense] Length = 558 Score = 100 bits (249), Expect = 1e-19 Identities = 47/60 (78%), Positives = 53/60 (88%) Frame = -1 Query: 254 DNSGYITREELRSAMEEHGMGDAATIKEIISEVDTDNDGRINYEEFCAMMRSGVQQNVKV 75 DNSG+ITREEL +AM +HGMGD ATIKEIISEVDTDNDGRINYEEFCAMMRSG+ ++ Sbjct: 498 DNSGHITREELETAMTKHGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGMPHQAQL 557 >ref|XP_003617547.1| Calcium dependent protein kinase [Medicago truncatula] gi|355518882|gb|AET00506.1| Calcium dependent protein kinase [Medicago truncatula] Length = 1052 Score = 100 bits (249), Expect = 1e-19 Identities = 47/59 (79%), Positives = 53/59 (89%) Frame = -1 Query: 254 DNSGYITREELRSAMEEHGMGDAATIKEIISEVDTDNDGRINYEEFCAMMRSGVQQNVK 78 DNSG+ITR+EL +AM+E+GMGD TI+EIISEVDTDNDGRINYEEFC MMRSGVQQ K Sbjct: 506 DNSGFITRDELETAMKEYGMGDEETIREIISEVDTDNDGRINYEEFCTMMRSGVQQQGK 564