BLASTX nr result
ID: Dioscorea21_contig00027405
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00027405 (474 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EGI65196.1| Protein SSXT [Acromyrmex echinatior] 56 3e-06 >gb|EGI65196.1| Protein SSXT [Acromyrmex echinatior] Length = 613 Score = 55.8 bits (133), Expect = 3e-06 Identities = 33/97 (34%), Positives = 47/97 (48%) Frame = -2 Query: 326 HPNHPDSSSPHTKSPNSNHQIPQKSPDNPLQTAFLHREHHQNPQIPPEAQEKESNTKPQA 147 HP HP PHT+SP+ P + P P + H+ HQ+P PP+ +++S T PQ Sbjct: 435 HPPHPPP--PHTQSPHQPPHTPHQPPHQPTHQSS-HQPPHQSPHQPPQQSQQQSQTAPQT 491 Query: 146 HQRSQRNQQPWRNPQGTKRTCSRASPPSAPPLEKVQP 36 Q Q +Q P P G + P+ PP + QP Sbjct: 492 QQ--QPSQSP--APSGFQPPSGPPQGPAPPPGPQQQP 524