BLASTX nr result
ID: Dioscorea21_contig00027320
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00027320 (338 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511462.1| conserved hypothetical protein [Ricinus comm... 55 8e-06 >ref|XP_002511462.1| conserved hypothetical protein [Ricinus communis] gi|223550577|gb|EEF52064.1| conserved hypothetical protein [Ricinus communis] Length = 81 Score = 54.7 bits (130), Expect = 8e-06 Identities = 29/46 (63%), Positives = 30/46 (65%), Gaps = 2/46 (4%) Frame = -3 Query: 330 NNKKNS--GLEKTKAVASTGLQKTKAVASTGFKKVKEGTTLGFHWI 199 N+K NS K K GL KTK VASTGFKKVKEGT GFHWI Sbjct: 25 NSKSNSTSSTAKYKQKVGEGLGKTKEVASTGFKKVKEGTVSGFHWI 70