BLASTX nr result
ID: Dioscorea21_contig00027306
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00027306 (283 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513279.1| Protein regulator of cytokinesis, putative [... 56 3e-06 ref|XP_002511727.1| PLE, putative [Ricinus communis] gi|22354890... 55 8e-06 >ref|XP_002513279.1| Protein regulator of cytokinesis, putative [Ricinus communis] gi|223547653|gb|EEF49147.1| Protein regulator of cytokinesis, putative [Ricinus communis] Length = 724 Score = 56.2 bits (134), Expect = 3e-06 Identities = 31/58 (53%), Positives = 39/58 (67%), Gaps = 1/58 (1%) Frame = -2 Query: 279 TPQTLPIMTPKTPSTVSMPMQVANTPA-PVFAYEIASGAAEKTTERIEDIEYSFEEKR 109 TP+T+PI P TPST+S+PMQ A TPA PV + G A E E++EYSFEE+R Sbjct: 655 TPKTMPIPVPTTPSTLSVPMQTAITPAHPV---PVPYGGATPKEEVPEEVEYSFEERR 709 >ref|XP_002511727.1| PLE, putative [Ricinus communis] gi|223548907|gb|EEF50396.1| PLE, putative [Ricinus communis] Length = 725 Score = 54.7 bits (130), Expect = 8e-06 Identities = 29/57 (50%), Positives = 36/57 (63%) Frame = -2 Query: 279 TPQTLPIMTPKTPSTVSMPMQVANTPAPVFAYEIASGAAEKTTERIEDIEYSFEEKR 109 TP+TLPI P TP+T+S PM +A+TPA S AA + +E IEYSFEE R Sbjct: 646 TPKTLPIPVPTTPTTISTPMLMASTPAT----PCVSSAASTAEKVVEQIEYSFEEVR 698