BLASTX nr result
ID: Dioscorea21_contig00027193
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00027193 (225 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEC81677.1| hypothetical protein OsI_25239 [Oryza sativa Indi... 62 6e-08 gb|AAF40460.1|AC004809_18 Strong similarity to the synaptobrevin... 59 3e-07 tpg|DAA42470.1| TPA: putative vesicle-associated membrane protei... 59 4e-07 tpg|DAA42471.1| TPA: putative vesicle-associated membrane protei... 59 5e-07 gb|AAY41423.1| putative synaptobrevin-like protein [Ipomoea bata... 58 7e-07 >gb|EEC81677.1| hypothetical protein OsI_25239 [Oryza sativa Indica Group] gi|222636602|gb|EEE66734.1| hypothetical protein OsJ_23425 [Oryza sativa Japonica Group] Length = 249 Score = 61.6 bits (148), Expect = 6e-08 Identities = 38/74 (51%), Positives = 45/74 (60%) Frame = +3 Query: 3 VMMENIEKVLDRGEKIEVLVDKTENLRSQVHKKLQTP*LWR*YREIDSNLLTISVSENIT 182 VMMENIEKVLDRGEKIE+LVDKTENLRSQ ++ + +W LT+ + Sbjct: 157 VMMENIEKVLDRGEKIELLVDKTENLRSQKYRIMVPKVIW----------LTVDM----- 201 Query: 183 HSVL*LQAQDFRQQ 224 AQDFRQQ Sbjct: 202 -------AQDFRQQ 208 >gb|AAF40460.1|AC004809_18 Strong similarity to the synaptobrevin homolog F25I18.14 gi|2924792 from A. thaliana on BAC gb|AC002334 [Arabidopsis thaliana] Length = 229 Score = 59.3 bits (142), Expect = 3e-07 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +3 Query: 3 VMMENIEKVLDRGEKIEVLVDKTENLRSQVH 95 VMMENIEKVLDRGEKIE+LVDKTENLRSQV+ Sbjct: 144 VMMENIEKVLDRGEKIELLVDKTENLRSQVN 174 >tpg|DAA42470.1| TPA: putative vesicle-associated membrane protein family protein [Zea mays] Length = 176 Score = 58.9 bits (141), Expect = 4e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +3 Query: 3 VMMENIEKVLDRGEKIEVLVDKTENLRSQV 92 VMMENIEKVLDRGEKIE+LVDKTENLRSQV Sbjct: 144 VMMENIEKVLDRGEKIELLVDKTENLRSQV 173 >tpg|DAA42471.1| TPA: putative vesicle-associated membrane protein family protein [Zea mays] Length = 189 Score = 58.5 bits (140), Expect = 5e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +3 Query: 3 VMMENIEKVLDRGEKIEVLVDKTENLRSQV 92 VMMENIEKVLDRGEKIE+LVDKTENLRSQ+ Sbjct: 144 VMMENIEKVLDRGEKIELLVDKTENLRSQI 173 >gb|AAY41423.1| putative synaptobrevin-like protein [Ipomoea batatas] Length = 87 Score = 58.2 bits (139), Expect = 7e-07 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +3 Query: 3 VMMENIEKVLDRGEKIEVLVDKTENLRSQ 89 VMMENIEKVLDRGEKIE+LVDKTENLRSQ Sbjct: 11 VMMENIEKVLDRGEKIEILVDKTENLRSQ 39