BLASTX nr result
ID: Dioscorea21_contig00027084
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00027084 (203 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519292.1| yth domain-containing protein, putative [Ric... 57 2e-06 >ref|XP_002519292.1| yth domain-containing protein, putative [Ricinus communis] gi|223541607|gb|EEF43156.1| yth domain-containing protein, putative [Ricinus communis] Length = 706 Score = 57.0 bits (136), Expect = 2e-06 Identities = 32/62 (51%), Positives = 36/62 (58%) Frame = +1 Query: 16 NPQLASTPPLEDIDYMGNETAPEVLLDQGLXXXXXXXXXXXXCTGFESPSELDDHHMFFG 195 NP L S P LE ++ M NE APE LDQGL CTGFESPSE +DH FG Sbjct: 34 NPLLTS-PLLEQVEAMYNEGAPEFFLDQGLYYPTAANFGYY-CTGFESPSEWEDHRRIFG 91 Query: 196 ID 201 +D Sbjct: 92 VD 93