BLASTX nr result
ID: Dioscorea21_contig00026616
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00026616 (310 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513375.1| pentatricopeptide repeat-containing protein,... 72 4e-11 ref|XP_004139834.1| PREDICTED: uncharacterized protein LOC101214... 70 1e-10 ref|XP_002307188.1| predicted protein [Populus trichocarpa] gi|2... 69 3e-10 ref|XP_002310675.1| predicted protein [Populus trichocarpa] gi|2... 69 3e-10 ref|XP_002336594.1| predicted protein [Populus trichocarpa] gi|2... 69 3e-10 >ref|XP_002513375.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223547283|gb|EEF48778.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 922 Score = 72.4 bits (176), Expect = 4e-11 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = +3 Query: 3 LSSEQARDQFSGFMKDWNNHKLDSRYYEGIASGPRTAHNWKIR 131 LSSE AR+ F+ F+KDWNN KLD +YYEGI+SGPR+AHNW R Sbjct: 106 LSSESAREMFTDFVKDWNNQKLDPQYYEGISSGPRSAHNWTFR 148 >ref|XP_004139834.1| PREDICTED: uncharacterized protein LOC101214792 [Cucumis sativus] Length = 158 Score = 70.5 bits (171), Expect = 1e-10 Identities = 30/43 (69%), Positives = 38/43 (88%) Frame = +3 Query: 3 LSSEQARDQFSGFMKDWNNHKLDSRYYEGIASGPRTAHNWKIR 131 LSSE AR+ FS F++ WN+ KL+SRYYEGI+SGPRT+HNWKI+ Sbjct: 115 LSSESARELFSDFVELWNDRKLESRYYEGISSGPRTSHNWKIK 157 >ref|XP_002307188.1| predicted protein [Populus trichocarpa] gi|222856637|gb|EEE94184.1| predicted protein [Populus trichocarpa] Length = 159 Score = 69.3 bits (168), Expect = 3e-10 Identities = 29/43 (67%), Positives = 37/43 (86%) Frame = +3 Query: 3 LSSEQARDQFSGFMKDWNNHKLDSRYYEGIASGPRTAHNWKIR 131 L+SE AR+ FS F+KDWN KL+SRYYEGI+SGPR+AHNW ++ Sbjct: 116 LTSESARELFSVFVKDWNAQKLESRYYEGISSGPRSAHNWALK 158 >ref|XP_002310675.1| predicted protein [Populus trichocarpa] gi|222853578|gb|EEE91125.1| predicted protein [Populus trichocarpa] Length = 81 Score = 69.3 bits (168), Expect = 3e-10 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = +3 Query: 3 LSSEQARDQFSGFMKDWNNHKLDSRYYEGIASGPRTAHNWKIRK 134 LSSE AR+ FS F+KDWN+ KL+SRYYEGI+S PR+AHNW ++ Sbjct: 38 LSSESARELFSVFVKDWNSQKLESRYYEGISSAPRSAHNWAFKR 81 >ref|XP_002336594.1| predicted protein [Populus trichocarpa] gi|222836274|gb|EEE74695.1| predicted protein [Populus trichocarpa] Length = 76 Score = 69.3 bits (168), Expect = 3e-10 Identities = 29/43 (67%), Positives = 37/43 (86%) Frame = +3 Query: 3 LSSEQARDQFSGFMKDWNNHKLDSRYYEGIASGPRTAHNWKIR 131 L+SE AR+ FS F+KDWN KL+SRYYEGI+SGPR+AHNW ++ Sbjct: 33 LTSESARELFSVFVKDWNAQKLESRYYEGISSGPRSAHNWALK 75