BLASTX nr result
ID: Dioscorea21_contig00026586
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00026586 (293 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004147288.1| PREDICTED: iron-sulfur assembly protein IscA... 90 2e-16 ref|XP_004152897.1| PREDICTED: iron-sulfur assembly protein IscA... 90 2e-16 emb|CCH47175.1| similar to iron-sulfur assembly protein IscA-lik... 89 5e-16 gb|AFK37566.1| unknown [Lotus japonicus] 89 5e-16 ref|XP_003535638.1| PREDICTED: LOW QUALITY PROTEIN: iron-sulfur ... 89 5e-16 >ref|XP_004147288.1| PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial-like [Cucumis sativus] Length = 155 Score = 90.1 bits (222), Expect = 2e-16 Identities = 43/46 (93%), Positives = 44/46 (95%) Frame = -3 Query: 291 VDNISYDFVKGATVDYVEELIRSAFQVVTNPSAVGGCSCKSSFMVK 154 VDNISYDFVKGAT+DYVEELIRSAF V TNPSAVGGCSCKSSFMVK Sbjct: 109 VDNISYDFVKGATIDYVEELIRSAFIVTTNPSAVGGCSCKSSFMVK 154 >ref|XP_004152897.1| PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial-like [Cucumis sativus] gi|449505888|ref|XP_004162595.1| PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial-like [Cucumis sativus] Length = 157 Score = 89.7 bits (221), Expect = 2e-16 Identities = 43/46 (93%), Positives = 44/46 (95%) Frame = -3 Query: 291 VDNISYDFVKGATVDYVEELIRSAFQVVTNPSAVGGCSCKSSFMVK 154 VDNISYDFVKGAT+DYVEELIRSAF V TNPSAVGGCSCKSSFMVK Sbjct: 111 VDNISYDFVKGATIDYVEELIRSAFVVSTNPSAVGGCSCKSSFMVK 156 >emb|CCH47175.1| similar to iron-sulfur assembly protein IscA-like [Lupinus angustifolius] Length = 221 Score = 88.6 bits (218), Expect = 5e-16 Identities = 43/46 (93%), Positives = 43/46 (93%) Frame = -3 Query: 291 VDNISYDFVKGATVDYVEELIRSAFQVVTNPSAVGGCSCKSSFMVK 154 VDNISYDFVKGATVDYVEELIRSAF V NPSAVGGCSCKSSFMVK Sbjct: 176 VDNISYDFVKGATVDYVEELIRSAFVVTENPSAVGGCSCKSSFMVK 221 >gb|AFK37566.1| unknown [Lotus japonicus] Length = 161 Score = 88.6 bits (218), Expect = 5e-16 Identities = 43/46 (93%), Positives = 43/46 (93%) Frame = -3 Query: 291 VDNISYDFVKGATVDYVEELIRSAFQVVTNPSAVGGCSCKSSFMVK 154 VDNISYDFVKGATVDYVEELIRSAF V NPSAVGGCSCKSSFMVK Sbjct: 115 VDNISYDFVKGATVDYVEELIRSAFVVTENPSAVGGCSCKSSFMVK 160 >ref|XP_003535638.1| PREDICTED: LOW QUALITY PROTEIN: iron-sulfur assembly protein IscA-like 2, mitochondrial-like [Glycine max] Length = 155 Score = 88.6 bits (218), Expect = 5e-16 Identities = 43/46 (93%), Positives = 43/46 (93%) Frame = -3 Query: 291 VDNISYDFVKGATVDYVEELIRSAFQVVTNPSAVGGCSCKSSFMVK 154 VDNISYDFVKGATVDYVEELIRSAF V NPSAVGGCSCKSSFMVK Sbjct: 109 VDNISYDFVKGATVDYVEELIRSAFVVTENPSAVGGCSCKSSFMVK 154