BLASTX nr result
ID: Dioscorea21_contig00026330
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00026330 (418 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW82142.1| hypothetical protein ZEAMMB73_402058 [Zea mays] 59 5e-07 ref|XP_002441042.1| hypothetical protein SORBIDRAFT_09g019276 [S... 57 1e-06 ref|XP_003566295.1| PREDICTED: phospholipase A1-Igamma1, chlorop... 57 2e-06 gb|EEE63596.1| hypothetical protein OsJ_18413 [Oryza sativa Japo... 57 2e-06 gb|EEC79153.1| hypothetical protein OsI_19824 [Oryza sativa Indi... 57 2e-06 >gb|AFW82142.1| hypothetical protein ZEAMMB73_402058 [Zea mays] Length = 576 Score = 58.5 bits (140), Expect = 5e-07 Identities = 24/35 (68%), Positives = 31/35 (88%) Frame = -3 Query: 107 QENLPSRWPEIHGSENWSGLLDPIDPLLRSELMRY 3 ++ L SRW EIHG ++W+GLLDP+DPLLRSEL+RY Sbjct: 112 RDELRSRWREIHGCDDWAGLLDPMDPLLRSELIRY 146 >ref|XP_002441042.1| hypothetical protein SORBIDRAFT_09g019276 [Sorghum bicolor] gi|241946327|gb|EES19472.1| hypothetical protein SORBIDRAFT_09g019276 [Sorghum bicolor] Length = 478 Score = 57.4 bits (137), Expect = 1e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -3 Query: 104 ENLPSRWPEIHGSENWSGLLDPIDPLLRSELMRY 3 E L RW EIHG ++W+GLLDP+DPLLRSEL+RY Sbjct: 121 EELRRRWREIHGCDDWAGLLDPMDPLLRSELIRY 154 >ref|XP_003566295.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Brachypodium distachyon] Length = 537 Score = 57.0 bits (136), Expect = 2e-06 Identities = 23/35 (65%), Positives = 30/35 (85%) Frame = -3 Query: 107 QENLPSRWPEIHGSENWSGLLDPIDPLLRSELMRY 3 Q+ L +RW EIHG ++W+GLLDP+DP LRSEL+RY Sbjct: 98 QDELAARWREIHGCDDWAGLLDPMDPQLRSELIRY 132 >gb|EEE63596.1| hypothetical protein OsJ_18413 [Oryza sativa Japonica Group] Length = 534 Score = 56.6 bits (135), Expect = 2e-06 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = -3 Query: 98 LPSRWPEIHGSENWSGLLDPIDPLLRSELMRY 3 L +RW EIHG ++W+GLLDP+DPLLRSEL+RY Sbjct: 122 LAARWREIHGRDDWAGLLDPMDPLLRSELIRY 153 >gb|EEC79153.1| hypothetical protein OsI_19824 [Oryza sativa Indica Group] Length = 574 Score = 56.6 bits (135), Expect = 2e-06 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = -3 Query: 98 LPSRWPEIHGSENWSGLLDPIDPLLRSELMRY 3 L +RW EIHG ++W+GLLDP+DPLLRSEL+RY Sbjct: 119 LAARWREIHGRDDWAGLLDPMDPLLRSELIRY 150