BLASTX nr result
ID: Dioscorea21_contig00026178
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00026178 (292 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|Q9AXH9.1|KAO1_HORVU RecName: Full=Ent-kaurenoic acid oxidase ... 62 6e-08 gb|ACV91868.1| KAO1 [Hordeum vulgare subsp. vulgare] 62 6e-08 emb|CBY78889.1| KAO protein [Aegilops tauschii] 61 8e-08 emb|CBY78887.1| KAO protein [Aegilops speltoides] 61 8e-08 gb|ADZ55287.1| ent-kaurene acid oxidase [Triticum aestivum] 61 8e-08 >sp|Q9AXH9.1|KAO1_HORVU RecName: Full=Ent-kaurenoic acid oxidase 1; AltName: Full=gpr5 gi|13022042|gb|AAK11616.1|AF326277_1 ent-kaurenoic acid oxidase [Hordeum vulgare subsp. vulgare] gi|326525735|dbj|BAJ88914.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 499 Score = 61.6 bits (148), Expect = 6e-08 Identities = 27/35 (77%), Positives = 28/35 (80%) Frame = -1 Query: 292 LDYKLERLNPQCPVRYLPHPRPTDNCLAKITKFSS 188 L YKL R NP C VRYLPHPRP DNCLAKIT+ SS Sbjct: 462 LGYKLTRKNPNCRVRYLPHPRPVDNCLAKITRLSS 496 >gb|ACV91868.1| KAO1 [Hordeum vulgare subsp. vulgare] Length = 499 Score = 61.6 bits (148), Expect = 6e-08 Identities = 27/35 (77%), Positives = 28/35 (80%) Frame = -1 Query: 292 LDYKLERLNPQCPVRYLPHPRPTDNCLAKITKFSS 188 L YKL R NP C VRYLPHPRP DNCLAKIT+ SS Sbjct: 462 LGYKLTRKNPNCRVRYLPHPRPVDNCLAKITRLSS 496 >emb|CBY78889.1| KAO protein [Aegilops tauschii] Length = 493 Score = 61.2 bits (147), Expect = 8e-08 Identities = 27/35 (77%), Positives = 28/35 (80%) Frame = -1 Query: 292 LDYKLERLNPQCPVRYLPHPRPTDNCLAKITKFSS 188 L YKL R NP C VRYLPHPRP DNCLAKIT+ SS Sbjct: 457 LGYKLTRKNPNCRVRYLPHPRPVDNCLAKITRVSS 491 >emb|CBY78887.1| KAO protein [Aegilops speltoides] Length = 492 Score = 61.2 bits (147), Expect = 8e-08 Identities = 27/35 (77%), Positives = 28/35 (80%) Frame = -1 Query: 292 LDYKLERLNPQCPVRYLPHPRPTDNCLAKITKFSS 188 L YKL R NP C VRYLPHPRP DNCLAKIT+ SS Sbjct: 456 LGYKLTRKNPNCRVRYLPHPRPVDNCLAKITRVSS 490 >gb|ADZ55287.1| ent-kaurene acid oxidase [Triticum aestivum] Length = 492 Score = 61.2 bits (147), Expect = 8e-08 Identities = 27/35 (77%), Positives = 28/35 (80%) Frame = -1 Query: 292 LDYKLERLNPQCPVRYLPHPRPTDNCLAKITKFSS 188 L YKL R NP C VRYLPHPRP DNCLAKIT+ SS Sbjct: 456 LGYKLTRKNPNCRVRYLPHPRPVDNCLAKITRVSS 490