BLASTX nr result
ID: Dioscorea21_contig00026119
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00026119 (313 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|P48407.1|DPS1_PINST RecName: Full=Pinosylvin synthase 1; AltN... 122 2e-26 pdb|1U0U|A Chain A, An Aldol Switch Discovered In Stilbene Synth... 122 4e-26 sp|P48408.1|DPS2_PINST RecName: Full=Pinosylvin synthase 2; AltN... 120 1e-25 pdb|1XES|A Chain A, Crystal Structure Of Stilbene Synthase From ... 120 1e-25 gb|AAB24341.2| pinosylvin-forming stilbene synthase [Pinus sylve... 119 2e-25 >sp|P48407.1|DPS1_PINST RecName: Full=Pinosylvin synthase 1; AltName: Full=Stilbene synthase 1; Short=STS 1 gi|762992|emb|CAA87012.1| stilbene synthase [Pinus strobus] gi|1095543|prf||2109262B stilbene synthase:ISOTYPE=1 Length = 396 Score = 122 bits (307), Expect = 2e-26 Identities = 55/87 (63%), Positives = 70/87 (80%) Frame = -1 Query: 265 KAKKGGGLASVLALGTANPPNVFYQDAFPDFYFRITNNEHKVELKNKFKRICEGSMIKKR 86 K+++ G AS+LA+GTANPPNV Q +PD+YFR+TNNE +LK+KFKRICE S IKKR Sbjct: 14 KSQRADGFASILAIGTANPPNVVDQSTYPDYYFRVTNNEDNTDLKDKFKRICERSAIKKR 73 Query: 85 HMFWTEEMLKQKPNVCAFMEENSLDTR 5 HM+ TEE+LK+ P +CAF+E SLDTR Sbjct: 74 HMYLTEEILKKNPELCAFLEVPSLDTR 100 >pdb|1U0U|A Chain A, An Aldol Switch Discovered In Stilbene Synthases Mediates Cyclization Specificity Of Type Iii Polyketide Synthases: Pine Stilbene Synthase Structure gi|56554106|pdb|1U0U|B Chain B, An Aldol Switch Discovered In Stilbene Synthases Mediates Cyclization Specificity Of Type Iii Polyketide Synthases: Pine Stilbene Synthase Structure gi|56554107|pdb|1U0U|C Chain C, An Aldol Switch Discovered In Stilbene Synthases Mediates Cyclization Specificity Of Type Iii Polyketide Synthases: Pine Stilbene Synthase Structure gi|56554108|pdb|1U0U|D Chain D, An Aldol Switch Discovered In Stilbene Synthases Mediates Cyclization Specificity Of Type Iii Polyketide Synthases: Pine Stilbene Synthase Structure gi|56554109|pdb|1U0U|E Chain E, An Aldol Switch Discovered In Stilbene Synthases Mediates Cyclization Specificity Of Type Iii Polyketide Synthases: Pine Stilbene Synthase Structure gi|56554110|pdb|1U0U|F Chain F, An Aldol Switch Discovered In Stilbene Synthases Mediates Cyclization Specificity Of Type Iii Polyketide Synthases: Pine Stilbene Synthase Structure Length = 397 Score = 122 bits (305), Expect = 4e-26 Identities = 59/100 (59%), Positives = 74/100 (74%), Gaps = 3/100 (3%) Frame = -1 Query: 295 NNGSNGVDDH---KAKKGGGLASVLALGTANPPNVFYQDAFPDFYFRITNNEHKVELKNK 125 ++G GVD K ++ G AS+LA+GTANPPN Q +PDFYFRIT NEH ELK+K Sbjct: 2 SHGMGGVDFEGFRKLQRADGFASILAIGTANPPNAVDQSTYPDFYFRITGNEHNTELKDK 61 Query: 124 FKRICEGSMIKKRHMFWTEEMLKQKPNVCAFMEENSLDTR 5 FKRICE S IK+R+M+ TEE+LK+ P+VCAF+E SLD R Sbjct: 62 FKRICERSAIKQRYMYLTEEILKKNPDVCAFVEVPSLDAR 101 >sp|P48408.1|DPS2_PINST RecName: Full=Pinosylvin synthase 2; AltName: Full=Stilbene synthase 2; Short=STS 2 gi|762994|emb|CAA87013.1| stilbene synthase [Pinus strobus] gi|1095542|prf||2109262A stilbene synthase:ISOTYPE=2 Length = 396 Score = 120 bits (301), Expect = 1e-25 Identities = 55/87 (63%), Positives = 69/87 (79%) Frame = -1 Query: 265 KAKKGGGLASVLALGTANPPNVFYQDAFPDFYFRITNNEHKVELKNKFKRICEGSMIKKR 86 K+++ G AS+LA+GTANPPNV Q +PD+YFR TNNE +LK+KFKRICE S IKKR Sbjct: 14 KSQRADGFASILAIGTANPPNVVDQSTYPDYYFRNTNNEDNTDLKDKFKRICERSAIKKR 73 Query: 85 HMFWTEEMLKQKPNVCAFMEENSLDTR 5 HM+ TEE+LK+ P +CAF+E SLDTR Sbjct: 74 HMYLTEEILKKNPELCAFLEVPSLDTR 100 >pdb|1XES|A Chain A, Crystal Structure Of Stilbene Synthase From Pinus Sylvestris gi|99031630|pdb|1XES|B Chain B, Crystal Structure Of Stilbene Synthase From Pinus Sylvestris gi|99031631|pdb|1XES|C Chain C, Crystal Structure Of Stilbene Synthase From Pinus Sylvestris gi|99031632|pdb|1XES|D Chain D, Crystal Structure Of Stilbene Synthase From Pinus Sylvestris gi|99031633|pdb|1XET|A Chain A, Crystal Structure Of Stilbene Synthase From Pinus Sylvestris, Complexed With Methylmalonyl Coa gi|99031634|pdb|1XET|B Chain B, Crystal Structure Of Stilbene Synthase From Pinus Sylvestris, Complexed With Methylmalonyl Coa gi|99031635|pdb|1XET|C Chain C, Crystal Structure Of Stilbene Synthase From Pinus Sylvestris, Complexed With Methylmalonyl Coa gi|99031636|pdb|1XET|D Chain D, Crystal Structure Of Stilbene Synthase From Pinus Sylvestris, Complexed With Methylmalonyl Coa Length = 413 Score = 120 bits (300), Expect = 1e-25 Identities = 61/104 (58%), Positives = 76/104 (73%), Gaps = 5/104 (4%) Frame = -1 Query: 301 MVNNGSN--GVDDH---KAKKGGGLASVLALGTANPPNVFYQDAFPDFYFRITNNEHKVE 137 +V GS+ GVD K ++ G AS+LA+GTANPPN Q +PDFYFRIT NEH E Sbjct: 14 LVPRGSHMGGVDFEGFRKLQRADGFASILAIGTANPPNAVDQSTYPDFYFRITGNEHNTE 73 Query: 136 LKNKFKRICEGSMIKKRHMFWTEEMLKQKPNVCAFMEENSLDTR 5 LK+KFKRICE S IK+R+M+ TEE+LK+ P+VCAF+E SLD R Sbjct: 74 LKDKFKRICERSAIKQRYMYLTEEILKKNPDVCAFVEVPSLDAR 117 >gb|AAB24341.2| pinosylvin-forming stilbene synthase [Pinus sylvestris] Length = 392 Score = 119 bits (299), Expect = 2e-25 Identities = 55/87 (63%), Positives = 68/87 (78%) Frame = -1 Query: 265 KAKKGGGLASVLALGTANPPNVFYQDAFPDFYFRITNNEHKVELKNKFKRICEGSMIKKR 86 K ++ G AS+LA+GTANPPN Q +PDFYFRIT NEH ELK+KFKRICE S IK+R Sbjct: 11 KLQRADGFASILAIGTANPPNAVDQSTYPDFYFRITGNEHNTELKDKFKRICERSAIKQR 70 Query: 85 HMFWTEEMLKQKPNVCAFMEENSLDTR 5 +M+ TEE+LK+ P+VCAF+E SLD R Sbjct: 71 YMYLTEEILKKNPDVCAFVEVPSLDAR 97