BLASTX nr result
ID: Dioscorea21_contig00025423
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00025423 (547 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003600228.1| Cc-nbs resistance protein [Medicago truncatu... 56 3e-06 >ref|XP_003600228.1| Cc-nbs resistance protein [Medicago truncatula] gi|355489276|gb|AES70479.1| Cc-nbs resistance protein [Medicago truncatula] Length = 983 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/60 (43%), Positives = 34/60 (56%) Frame = +2 Query: 53 MWCSPSSPRQAFATVCXXXXXXXXXXXXXHLSYVNVEPQRARTIARDNLLREYLRNKYGY 232 +WC ++ + + HLSYVNVEPQRART+ARD L+ + LR KYGY Sbjct: 905 VWCFTTTSKDLAMAIACSLSGAVMLAVGVHLSYVNVEPQRARTLARDKLVLDTLRKKYGY 964