BLASTX nr result
ID: Dioscorea21_contig00025379
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00025379 (237 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003565773.1| PREDICTED: uncharacterized protein LOC100832... 71 1e-10 ref|XP_002530574.1| something about silencing protein sas10, put... 71 1e-10 gb|ABI34329.1| Integrase core domain containing protein [Solanum... 69 4e-10 tpg|DAA47838.1| TPA: hypothetical protein ZEAMMB73_681100 [Zea m... 69 5e-10 ref|XP_002444808.1| hypothetical protein SORBIDRAFT_07g028350 [S... 68 9e-10 >ref|XP_003565773.1| PREDICTED: uncharacterized protein LOC100832433 [Brachypodium distachyon] Length = 648 Score = 70.9 bits (172), Expect = 1e-10 Identities = 39/80 (48%), Positives = 48/80 (60%), Gaps = 3/80 (3%) Frame = -3 Query: 232 FTNSKDESKQKNSSKALNKRLETQDDFDDEVQPVANGGTHSISKLSKLIPNKGN---KSK 62 + +S K N+ NK L+T DDFDDEVQ + K KL+ N N K+K Sbjct: 417 YKSSGKPEKLSNTRTTKNKNLQTLDDFDDEVQK-----NTQVMKTKKLLVNAANSNIKNK 471 Query: 61 FVSGDDDVPMRDDIGERRRK 2 FVSGDDD+P RD+IGERRRK Sbjct: 472 FVSGDDDIPKRDEIGERRRK 491 >ref|XP_002530574.1| something about silencing protein sas10, putative [Ricinus communis] gi|223529873|gb|EEF31804.1| something about silencing protein sas10, putative [Ricinus communis] Length = 639 Score = 70.9 bits (172), Expect = 1e-10 Identities = 39/78 (50%), Positives = 51/78 (65%), Gaps = 9/78 (11%) Frame = -3 Query: 208 KQKNSSKALNKRLETQDDFDDEVQPVANG------GTHSI---SKLSKLIPNKGNKSKFV 56 K + K++N++LET DDF+D+ V G G S+ SKLS+L+ K NK K + Sbjct: 412 KAQKHPKSVNRQLETYDDFNDDAIDVERGNHGLSNGQASLLGSSKLSQLVSAKANKPKAI 471 Query: 55 SGDDDVPMRDDIGERRRK 2 SGDDD+P RDDIGERRRK Sbjct: 472 SGDDDLPKRDDIGERRRK 489 >gb|ABI34329.1| Integrase core domain containing protein [Solanum demissum] Length = 1775 Score = 68.9 bits (167), Expect = 4e-10 Identities = 34/75 (45%), Positives = 49/75 (65%), Gaps = 1/75 (1%) Frame = -3 Query: 223 SKDESKQKNSSKALNKRLETQDDFDDEVQPVANGG-THSISKLSKLIPNKGNKSKFVSGD 47 ++ K+ S+ LN L T DDFDD+ + T S++KLS+L+ ++ + K +SGD Sbjct: 1550 ARKNEKENKRSRLLNGMLATPDDFDDDAMGAEDDRETRSLNKLSRLLTSQVARPKIISGD 1609 Query: 46 DDVPMRDDIGERRRK 2 DD+P RDDIGERRRK Sbjct: 1610 DDLPKRDDIGERRRK 1624 >tpg|DAA47838.1| TPA: hypothetical protein ZEAMMB73_681100 [Zea mays] Length = 633 Score = 68.6 bits (166), Expect = 5e-10 Identities = 40/80 (50%), Positives = 48/80 (60%), Gaps = 2/80 (2%) Frame = -3 Query: 235 NFTNSKDESKQKNSSKALNKRLETQDDFDDEVQPVANGGTHSISKLSKLIPN--KGNKSK 62 N T SK E K + + L+T DDFDDEV + + K SKL+ K NKS Sbjct: 406 NLTRSKPEKSSKTRTTSDKSGLQTLDDFDDEVLK-----NNQMMKPSKLVAAAAKSNKSM 460 Query: 61 FVSGDDDVPMRDDIGERRRK 2 FVSGDDD+P RD+IGERRRK Sbjct: 461 FVSGDDDLPKRDNIGERRRK 480 >ref|XP_002444808.1| hypothetical protein SORBIDRAFT_07g028350 [Sorghum bicolor] gi|241941158|gb|EES14303.1| hypothetical protein SORBIDRAFT_07g028350 [Sorghum bicolor] Length = 632 Score = 67.8 bits (164), Expect = 9e-10 Identities = 42/80 (52%), Positives = 49/80 (61%), Gaps = 2/80 (2%) Frame = -3 Query: 235 NFTNSKDESKQKNSSKALNKRLETQDDFDDEVQPVANGGTHSISKLSKLIPN--KGNKSK 62 N SK E K + + NK L+T DDFDDEV + I K SKL+ K NKS Sbjct: 403 NLKKSKPEKLSKTRTTS-NKGLQTLDDFDDEVLK-----NNQIMKPSKLVAAAAKSNKSM 456 Query: 61 FVSGDDDVPMRDDIGERRRK 2 FVSGDDD+P RD+IGERRRK Sbjct: 457 FVSGDDDLPKRDNIGERRRK 476